PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Prupe.4G070500.1.p | ||||||||
Common Name | FAR, PRUPE_ppa010595mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 244aa MW: 27991.7 Da PI: 9.8413 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.9 | 2e-31 | 25 | 74 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++g+lyey+ Prupe.4G070500.1.p 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLYEYA 74 79***********************************************8 PP | |||||||
2 | K-box | 118.8 | 4.6e-39 | 94 | 189 | 6 | 100 |
K-box 6 gks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 ++ ++ea ++++qqe+akL+++i nLq++ Rh++Ge+L+s+++k+L++Le++Lek++++iRskKnell+++ie++qk+e +l+++n+ Lr Prupe.4G070500.1.p 94 NTGsVSEASTQYYQQEAAKLRAQIGNLQNSSRHMMGESLSSMNMKDLKNLESKLEKGINRIRSKKNELLFAEIEYMQKREIDLHNNNQLLR 184 333599************************************************************************************* PP K-box 96 kklee 100 +k++e Prupe.4G070500.1.p 185 AKIAE 189 **986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.613 | 17 | 77 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 7.1E-41 | 17 | 76 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.03E-33 | 18 | 95 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 9.74E-45 | 18 | 92 | No hit | No description |
PRINTS | PR00404 | 5.9E-33 | 19 | 39 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 19 | 73 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.2E-26 | 26 | 73 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.9E-33 | 39 | 54 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.9E-33 | 54 | 75 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 7.0E-29 | 100 | 187 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.587 | 103 | 193 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0048440 | Biological Process | carpel development | ||||
GO:0048443 | Biological Process | stamen development | ||||
GO:0048497 | Biological Process | maintenance of floral organ identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 244 aa Download sequence Send to blast |
MAYENKSMSL DSPQRKLGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA 60 LIVFSNRGRL YEYANNSVKE TIERYKKACA ESTNTGSVSE ASTQYYQQEA AKLRAQIGNL 120 QNSSRHMMGE SLSSMNMKDL KNLESKLEKG INRIRSKKNE LLFAEIEYMQ KREIDLHNNN 180 QLLRAKIAEN ERSQQNINVM AGGGSYEIMQ SQPYDSRNYF QVNALQPNHQ YNSRQDPMAL 240 QLV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ppe.1710 | 0.0 | fruit |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Flower. Preferentially expressed in stamen and carpel and weakly in petal. Undetected in leaves and roots. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00609 | ChIP-seq | Transfer from AT4G18960 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Prupe.4G070500.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY705972 | 0.0 | AY705972.1 Prunus persica MADS4 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007211925.1 | 1e-179 | floral homeotic protein AGAMOUS isoform X2 | ||||
Refseq | XP_008225406.1 | 1e-179 | PREDICTED: floral homeotic protein AGAMOUS isoform X3 | ||||
Refseq | XP_008225408.1 | 1e-179 | PREDICTED: floral homeotic protein AGAMOUS isoform X2 | ||||
Refseq | XP_008225409.1 | 1e-179 | PREDICTED: floral homeotic protein AGAMOUS isoform X4 | ||||
Refseq | XP_020417372.1 | 1e-179 | floral homeotic protein AGAMOUS isoform X3 | ||||
Refseq | XP_021825649.1 | 1e-179 | floral homeotic protein AGAMOUS isoform X2 | ||||
Refseq | XP_021825651.1 | 1e-179 | floral homeotic protein AGAMOUS isoform X2 | ||||
Refseq | XP_021825652.1 | 1e-179 | floral homeotic protein AGAMOUS isoform X3 | ||||
Swissprot | Q40872 | 1e-130 | AG_PANGI; Floral homeotic protein AGAMOUS | ||||
TrEMBL | A7UGU4 | 1e-178 | A7UGU4_PRUMU; AGAMOUS-like protein | ||||
TrEMBL | A7UHZ1 | 1e-178 | A7UHZ1_PRUPE; AGAMOUS-like protein | ||||
TrEMBL | D9Z5S2 | 1e-178 | D9Z5S2_9ROSA; AGAMOUS-like protein | ||||
STRING | XP_008225406.1 | 1e-178 | (Prunus mume) | ||||
STRING | EMJ13124 | 1e-179 | (Prunus persica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF684 | 29 | 102 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18960.1 | 1e-126 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Prupe.4G070500.1.p |
Entrez Gene | 18778628 |
Publications ? help Back to Top | |||
---|---|---|---|
|