PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Prupe.2G247100.1.p

Common Name

PRUPE_ppa020183mg

Organism

Prunus persica

Taxonomic ID

3760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus

Family

WOX

Protein Properties

Length: 181aa MW: 20578.1 Da PI: 9.4741

Description

WOX family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Prupe.2G247100.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	65.4	7.9e-21	30	91	1	57
TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 ++ R+++t+eq+++L +lF++ r+ps++++++++++l +++ ++V++WFqN++a+e++ Prupe.2G247100.1.p 30 KCGRWNPTTEQVKVLTDLFRSgLRTPSTDQIQKISSQLsfygKIESKNVFYWFQNHKARERQ 91 568***************99************************************97 PP
2	Wus_type_Homeobox	114.6	5e-37	30	93	2	65
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 ++ RW+Pt+eQ+k+L++l++sGlrtP++++iq+i+++L+ yGkie+kNVfyWFQN+kaRerqk+ Prupe.2G247100.1.p 30 KCGRWNPTTEQVKVLTDLFRSGLRTPSTDQIQKISSQLSFYGKIESKNVFYWFQNHKARERQKR 93 678***********************************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50071	11.046	27	92	IPR001356	Homeobox domain
SMART	SM00389	3.9E-4	29	96	IPR001356	Homeobox domain
Pfam	PF00046	7.4E-18	31	91	IPR001356	Homeobox domain
SuperFamily	SSF46689	8.55E-12	32	94	IPR009057	Homeodomain-like
CDD	cd00086	2.22E-4	33	93	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.2E-8	33	91	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009733	Biological Process	response to auxin
GO:0010078	Biological Process	maintenance of root meristem identity
GO:1902459	Biological Process	positive regulation of stem cell population maintenance
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 181 aa Download sequence Send to blast
MDEGMSGFCI KAASFRGSGG GGNGNNNGTK CGRWNPTTEQ VKVLTDLFRS GLRTPSTDQI 60 QKISSQLSFY GKIESKNVFY WFQNHKARER QKRRKVSIDD KDFTRRDHDK ISSPKQLNQV 120 SEPARVIETL QLFPVNSFDE SEAEKMRFHA NEYCKEATAF AYRVGTEMDH PPLDLRLSFL 180 *

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Specifically expressed in the hypophysis of the majority of early globular embryos, approximately one round of cell division after the 16-cell stage, but never at the 16-cell stage itself. After the division of the hypophysis, it is detected in the upper lens-shaped cell that gives rise to the QC, but not in the lower daughter cell that gives rise to the central root cap. Subsequently, in heart stage and bent cotyledon stage embryos, it is detected in the four cells of the QC, which are the direct descendants of the lens-shaped cell. Also expressed in patches of cells that appeared associated with the vascular primordium of the cotyledons. This expression is strongest in late heart stage embryos and then gradually decreases. {ECO:0000269\|PubMed:14711878}.
Uniprot	TISSUE SPECIFICITY: Specifically expressed in the central cells of a quiescent center (QC) of the root. {ECO:0000269\|PubMed:14711878}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor, which may be involved in the specification and maintenance of the stem cells (QC cells) in the root apical meristem (RAM). {ECO:0000269\|PubMed:25631790}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Prupe.2G247100.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KJ699116	2e-76	KJ699116.1 Rosa canina WUSCHEL-related homeobox protein (WOX1) gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007220856.1	1e-135	WUSCHEL-related homeobox 7
Swissprot	Q8H1D2	3e-66	WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBL	M5XSQ7	1e-133	M5XSQ7_PRUPE; Uncharacterized protein
STRING	EMJ22055	1e-134	(Prunus persica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF6014	34	52

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G11260.1	8e-64	WUSCHEL related homeobox 5

Link Out ? help Back to Top
Phytozome	Prupe.2G247100.1.p
Entrez Gene	18785280

Publications ? help Back to Top
Conte MG,Gaillard S,Droc G,Perin C Phylogenomics of plant genomes: a methodology for genome-wide searches for orthologs in plants. BMC Genomics, 2008. 9: p. 183 [PMID:18426584] Chu H, et al. A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice. J. Exp. Bot., 2013. 64(17): p. 5359-69 [PMID:24043854] Tian H,Niu T,Yu Q,Quan T,Ding Z Auxin gradient is crucial for the maintenance of root distal stem cell identity in Arabidopsis. Plant Signal Behav, 2013. 8(12): p. e26429 [PMID:24056047] Tian H,Jia Y,Niu T,Yu Q,Ding Z The key players of the primary root growth and development also function in lateral roots in Arabidopsis. Plant Cell Rep., 2014. 33(5): p. 745-53 [PMID:24504658] Reyes-Hernández BJ, et al. The root indeterminacy-to-determinacy developmental switch is operated through a folate-dependent pathway in Arabidopsis thaliana. New Phytol., 2014. 202(4): p. 1223-36 [PMID:24635769] Bennett T,van den Toorn A,Willemsen V,Scheres B Precise control of plant stem cell activity through parallel regulatory inputs. Development, 2014. 141(21): p. 4055-64 [PMID:25256342] Ji H, et al. PRL1 modulates root stem cell niche activity and meristem size through WOX5 and PLTs in Arabidopsis. Plant J., 2015. 81(3): p. 399-412 [PMID:25438658] Su YH,Liu YB,Bai B,Zhang XS Establishment of embryonic shoot-root axis is involved in auxin and cytokinin response during Arabidopsis somatic embryogenesis. Front Plant Sci, 2014. 5: p. 792 [PMID:25642237] Jia Y, et al. The Arabidopsis thaliana elongator complex subunit 2 epigenetically affects root development. J. Exp. Bot., 2015. 66(15): p. 4631-42 [PMID:25998905] Zhang M, et al. A tetratricopeptide repeat domain-containing protein SSR1 located in mitochondria is involved in root development and auxin polar transport in Arabidopsis. Plant J., 2015. 83(4): p. 582-99 [PMID:26072661] Kong X,Lu S,Tian H,Ding Z WOX5 is Shining in the Root Stem Cell Niche. Trends Plant Sci., 2015. 20(10): p. 601-603 [PMID:26440429] Hu X,Xu L Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis. Plant Physiol., 2016. 172(4): p. 2363-2373 [PMID:27784768] Zhang Y,Jiao Y,Jiao H,Zhao H,Zhu YX Two-Step Functional Innovation of the Stem-Cell Factors WUS/WOX5 during Plant Evolution. Mol. Biol. Evol., 2017. 34(3): p. 640-653 [PMID:28053005] Singh S, et al. Sirtinol, a Sir2 protein inhibitor, affects stem cell maintenance and root development in Arabidopsis thaliana by modulating auxin-cytokinin signaling components. Sci Rep, 2017. 7: p. 42450 [PMID:28195159] García-Gómez ML,Azpeitia E,Álvarez-Buylla ER A dynamic genetic-hormonal regulatory network model explains multiple cellular behaviors of the root apical meristem of Arabidopsis thaliana. PLoS Comput. Biol., 2017. 13(4): p. e1005488 [PMID:28426669] Long Y, et al. In vivo FRET-FLIM reveals cell-type-specific protein interactions in Arabidopsis roots. Nature, 2017. 548(7665): p. 97-102 [PMID:28746306] Bruno L, et al. In Arabidopsis thaliana Cadmium Impact on the Growth of Primary Root by Altering SCR Expression and Auxin-Cytokinin Cross-Talk. Front Plant Sci, 2017. 8: p. 1323 [PMID:28798767] Hu B, et al. Divergent regeneration-competent cells adopt a common mechanism for callus initiation in angiosperms. Regeneration (Oxf), 2017. 4(3): p. 132-139 [PMID:28975033] Lozano-Elena F,Planas-Riverola A,Vilarrasa-Blasi J,Schwab R,Caño-Delgado AI Paracrine brassinosteroid signaling at the stem cell niche controls cellular regeneration. J. Cell. Sci., 2019. [PMID:29242230] Xu C, et al. Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration. Nat Plants, 2018. 4(2): p. 108-115 [PMID:29358751] Dolzblasz A, et al. Impairment of Meristem Proliferation in Plants Lacking the Mitochondrial Protease AtFTSH4. Int J Mol Sci, 2018. [PMID:29538317]