PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Prupe.2G204700.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 222aa MW: 26073.7 Da PI: 7.7419 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 138.3 | 4.7e-43 | 11 | 139 | 3 | 128 |
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyat.gkrknratksgyWkatgkd 89 GfrF+Pt+eelv++yL+kk ++k+++++++i+e+di+k+ePw+Lp + ++ ++++fFs+rd ky + r+nr+tk+g+Wk+tgk+ Prupe.2G204700.2.p 11 CGFRFRPTEEELVNYYLRKKKQDKDFKVDHIIPEIDICKYEPWELPGlftEPESPYQDMFFFSPRDYKYINnRARTNRVTKRGFWKTTGKE 101 6***************************999***************6233333344588**********96378***************** PP NAM 90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 + ++ + g kktL+fy+gr + ++t+Wvmhey l Prupe.2G204700.2.p 102 RVIKG-ARGSNGRKKTLIFYEGRVTQCNRTNWVMHEYYL 139 *9999.77789**************************76 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.79E-45 | 7 | 164 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 45.775 | 9 | 164 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.1E-24 | 12 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 222 aa Download sequence Send to blast |
MSAKLVWAMD CGFRFRPTEE ELVNYYLRKK KQDKDFKVDH IIPEIDICKY EPWELPGLFT 60 EPESPYQDMF FFSPRDYKYI NNRARTNRVT KRGFWKTTGK ERVIKGARGS NGRKKTLIFY 120 EGRVTQCNRT NWVMHEYYLC EDEAIPNPKL AQQRDFVLCR LSKKADKHET SICAVAQPAY 180 AEWVGNSEEC SQPEELELVF PAHQLQDNIS GEMEFEISSK K* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-33 | 8 | 164 | 16 | 165 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-33 | 8 | 164 | 16 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-33 | 8 | 164 | 16 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-33 | 8 | 164 | 16 | 165 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-33 | 8 | 164 | 19 | 168 | NAC domain-containing protein 19 |
3swm_B | 3e-33 | 8 | 164 | 19 | 168 | NAC domain-containing protein 19 |
3swm_C | 3e-33 | 8 | 164 | 19 | 168 | NAC domain-containing protein 19 |
3swm_D | 3e-33 | 8 | 164 | 19 | 168 | NAC domain-containing protein 19 |
3swp_A | 3e-33 | 8 | 164 | 19 | 168 | NAC domain-containing protein 19 |
3swp_B | 3e-33 | 8 | 164 | 19 | 168 | NAC domain-containing protein 19 |
3swp_C | 3e-33 | 8 | 164 | 19 | 168 | NAC domain-containing protein 19 |
3swp_D | 3e-33 | 8 | 164 | 19 | 168 | NAC domain-containing protein 19 |
4dul_A | 2e-33 | 8 | 164 | 16 | 165 | NAC domain-containing protein 19 |
4dul_B | 2e-33 | 8 | 164 | 16 | 165 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, rosette leaves, cauline leaves, shoot apex, stems and flowers. {ECO:0000269|PubMed:17158162}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). {ECO:0000250|UniProtKB:Q949N0}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Prupe.2G204700.2.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cold, heat and drought stresses. {ECO:0000269|PubMed:17158162}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007219610.2 | 1e-161 | NAC domain-containing protein 86 | ||||
Swissprot | B5X570 | 6e-42 | NAC14_ARATH; NAC domain-containing protein 14 | ||||
TrEMBL | A0A251QIW0 | 1e-166 | A0A251QIW0_PRUPE; Uncharacterized protein | ||||
STRING | XP_008233242.1 | 1e-141 | (Prunus mume) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G33060.1 | 2e-44 | NAC 014 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Prupe.2G204700.2.p |