PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Prupe.2G191100.1.p | ||||||||
Common Name | PRUPE_ppa025888mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 155aa MW: 17763.5 Da PI: 6.9396 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 125 | 3.7e-39 | 15 | 114 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 +CaaC++lrr+C ++C lapyfp e+ +kfa vhk+FGasnv+k+++ ++e++reda+++lvyeA+ar+rdPvyG++g i++lq+ +e+l+ Prupe.2G191100.1.p 15 PCAACRMLRRRCDRNCSLAPYFPGEEIEKFAGVHKVFGASNVIKMIQMVEETRREDAVKALVYEARARLRDPVYGSTGAIFHLQKMIEELR 105 7****************************************************************************************** PP DUF260 92 aelallkee 100 ++l++++++ Prupe.2G191100.1.p 106 SQLESIRSQ 114 ***999876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.240.10 | 9.7E-4 | 9 | 29 | IPR001138 | Zn(2)-C6 fungal-type DNA-binding domain |
PROSITE profile | PS50891 | 25.52 | 14 | 115 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 5.7E-39 | 15 | 112 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MDTQVVPMHN RVHQPCAACR MLRRRCDRNC SLAPYFPGEE IEKFAGVHKV FGASNVIKMI 60 QMVEETRRED AVKALVYEAR ARLRDPVYGS TGAIFHLQKM IEELRSQLES IRSQVLELQQ 120 HRDQLLGILM NNVHCLEDDL FSTMHHDPMF GGDL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-35 | 5 | 116 | 1 | 112 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-35 | 5 | 116 | 1 | 112 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Prupe.2G191100.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007219714.2 | 1e-112 | LOB domain-containing protein 1 | ||||
Swissprot | Q9LQR0 | 7e-42 | LBD1_ARATH; LOB domain-containing protein 1 | ||||
TrEMBL | A0A251QIE2 | 1e-111 | A0A251QIE2_PRUPE; Uncharacterized protein | ||||
STRING | XP_008233120.1 | 1e-109 | (Prunus mume) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF14068 | 19 | 21 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G07900.1 | 3e-44 | LOB domain-containing protein 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Prupe.2G191100.1.p |
Entrez Gene | 18786015 |