PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Prupe.1G549600.3.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 222aa MW: 25519.2 Da PI: 9.7999 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.1 | 1.8e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELS+LCdaeva+i+fss+g+lyeys+ Prupe.1G549600.3.p 9 KRIENTTNRQVTFCKRRNGLLKKAYELSILCDAEVALIVFSSRGRLYEYSN 59 79***********************************************95 PP | |||||||
2 | K-box | 110.4 | 2e-36 | 78 | 173 | 5 | 100 |
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 ++s +e +a+++qqe+akL+++i++Lq+++Rhl+G+ L++Ls+keL+qLe++Le+++++iRskK+e+ll++ie+lqkke el++en +Lr Prupe.1G549600.3.p 78 GSTSITEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTLSVKELKQLENRLERGINRIRSKKHEMLLAEIEYLQKKEIELENENVCLR 168 34558999*********************************************************************************** PP K-box 96 kklee 100 +k+ e Prupe.1G549600.3.p 169 TKISE 173 **976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.1E-42 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.936 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 7.72E-33 | 2 | 74 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.97E-43 | 2 | 76 | No hit | No description |
PRINTS | PR00404 | 7.1E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.3E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.1E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.1E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.0E-27 | 86 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 16.108 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048283 | Biological Process | indeterminate inflorescence morphogenesis | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:0090376 | Biological Process | seed trichome differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 222 aa Download sequence Send to blast |
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSILCD AEVALIVFSS RGRLYEYSNN 60 NIRNTIERYK KACSDSSGST SITEINAQYY QQESAKLRQQ IQMLQNSNRH LMGDALSTLS 120 VKELKQLENR LERGINRIRS KKHEMLLAEI EYLQKKEIEL ENENVCLRTK ISEVERLQQA 180 NMVGPELNAI QALASRNFFS QNMMEGGATY PQQDKKILHL G* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 7e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 7e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 7e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 7e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 7e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 7e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 7e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 7e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 7e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 7e-21 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ppe.5421 | 0.0 | fruit |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and seeds (Ref.1). Expressed in endotesta cell layer of developing seeds (PubMed:28369525). {ECO:0000269|PubMed:28369525, ECO:0000269|Ref.1}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Prupe.1G549600.3.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY947462 | 0.0 | AY947462.1 Prunus dulcis MADS-box transcription factor (MADS1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020416253.1 | 1e-161 | agamous-like MADS-box protein AGL11 isoform X2 | ||||
Refseq | XP_021831176.1 | 1e-161 | agamous-like MADS-box protein AGL11 isoform X3 | ||||
Swissprot | F6I457 | 1e-134 | AG11C_VITVI; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | A0A251RIB3 | 1e-159 | A0A251RIB3_PRUPE; Uncharacterized protein | ||||
STRING | EMJ25145 | 1e-158 | (Prunus persica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.1 | 1e-120 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Prupe.1G549600.3.p |