PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Prupe.1G371300.5.p | ||||||||
Common Name | PRUPE_ppa026083mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 189aa MW: 21875.9 Da PI: 10.242 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 90.9 | 6.3e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien +nrqvt+skRrng++KKA+EL vLCda v++i++s++gk++ey+s Prupe.1G371300.5.p 9 KRIENATNRQVTYSKRRNGLFKKAHELTVLCDATVSLIMVSNSGKIHEYIS 59 79***********************************************86 PP | |||||||
2 | K-box | 61.9 | 2.5e-21 | 72 | 152 | 2 | 81 |
K-box 2 qkssgksleeakaeslqqelakLkkeienLqreqRhl.lGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelq 81 qk++g++ +++++e +q++l+kLk+ ++ L++++R++ lGe+L+++s+ eL+ +eq++e +++ iR++K + +e+ ++l+ Prupe.1G371300.5.p 72 QKTKGVDIWSSHYEAMQEHLKKLKEVNRRLRKQIRQRvLGECLNDMSFDELRGVEQEMEGAVEVIRKRKLRSATEMNRNLR 152 6788999***************************98538******************************999999888877 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.651 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.0E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.44E-37 | 2 | 80 | No hit | No description |
PRINTS | PR00404 | 3.6E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.44E-35 | 3 | 96 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 9.6E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.6E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.6E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.5E-12 | 82 | 152 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 11.107 | 84 | 174 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010093 | Biological Process | specification of floral organ identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MARGKIQIKR IENATNRQVT YSKRRNGLFK KAHELTVLCD ATVSLIMVSN SGKIHEYISP 60 STTTKQFFDQ FQKTKGVDIW SSHYEAMQEH LKKLKEVNRR LRKQIRQRVL GECLNDMSFD 120 ELRGVEQEME GAVEVIRKRK LRSATEMNRN LREFDARDDP HYGLVKNGRE DYESAFGYSS 180 NGGPRIFA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 5e-15 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6byy_B | 5e-15 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6byy_C | 5e-15 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6byy_D | 5e-15 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_A | 6e-15 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_B | 6e-15 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_C | 6e-15 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_D | 6e-15 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed during flower development in stamens and petals. {ECO:0000269|PubMed:17920788}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00077 | ChIP-seq | Transfer from AT3G54340 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Prupe.1G371300.5.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM243368 | 0.0 | KM243368.1 Prunus pseudocerasus APETALA3-like protein transcript variant 1 mRNA, complete cds, alternatively spliced. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007227134.1 | 1e-140 | floral homeotic protein DEFICIENS isoform X2 | ||||
Swissprot | E0CPH4 | 6e-84 | AP3_VITVI; Agamous-like MADS-box protein AP3 | ||||
TrEMBL | M5Y223 | 1e-138 | M5Y223_PRUPE; Uncharacterized protein | ||||
STRING | EMJ28333 | 1e-139 | (Prunus persica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54340.1 | 1e-72 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Prupe.1G371300.5.p |
Entrez Gene | 18791711 |
Publications ? help Back to Top | |||
---|---|---|---|
|