PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G237500.1.p
Common NamePRUPE_ppa026722mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 516aa    MW: 57213.2 Da    PI: 6.5073
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G237500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS364.71.3e-1111465151374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvs.elykalppsetseknsseelaalklfsevsPi 90 
                         lv++L++cAeav+ +d++ a++lL +l+ +a   g+++qR+a++f+++L+ rla  ++ + +  + p ++s+  s+e+  al+l +e++P 
  Prupe.1G237500.1.p 146 LVQQLIACAEAVACRDKAHASTLLYELRANAKVFGTSFQRVASCFVQGLSDRLALIQPlGAVGLIGPITKSTAFSAEKDEALHLVYEICPQ 236
                         689***************************************************9444145555566666666799999************ PP

                GRAS  91 lkfshltaNqaIleavegeervHiiDfdis....qGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                         ++f+h++aN  Ilea+ege+ vH+iD++++    +G QW +L+++La+R+ ++ ++lRiTgvg+    s+e+l+++g+ L+  A++++++f
  Prupe.1G237500.1.p 237 IQFGHFVANASILEAFEGESSVHVIDLGMTlglpHGYQWRNLIDSLANRAgQPLHRLRITGVGN----SAERLQAIGNDLKLHAQSMKLNF 323
                         **************************98763344788*************455569********....9********************** PP

                GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                         ef++ v++++e+l+++++++  g++l+Vn++lqlh l++es    +   +vL+++ +lsPk++++veq+++hn++ Fl rf+eal+ ysa+
  Prupe.1G237500.1.p 324 EFSA-VESSFENLKPQDFNLVDGDVLVVNSILQLHCLVKESRGALN---SVLQTLHQLSPKLMILVEQDTSHNGPFFLGRFMEALHNYSAI 410
                         ****.799******************************88877777...8***************************************** PP

                GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                         fdsl+a lp+ +  r+k+E++++g+ei+n+v+ceg +r+erhe++e+Wr+r+++aGF+p+pl+    +qa   l+    +gy+v e++g+l
  Prupe.1G237500.1.p 411 FDSLDAMLPKYDTRRAKMEQFYFGEEIKNIVSCEGPARVERHERVEQWRRRMRRAGFQPAPLKMI--AQAMKWLEINTCEGYTVVEDKGCL 499
                         **************************************************************865..5777777777778*********** PP

                GRAS 359 vlgWkdrpLvsvSaWr 374
                         v+gWk++p++++S+W+
  Prupe.1G237500.1.p 500 VFGWKSKPIIATSCWK 515
                         ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.248120497IPR005202Transcription factor GRAS
PfamPF035144.4E-109146515IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 516 aa     Download sequence    Send to blast
MASGLYVQAE FSGDNTSDEV IGLDLNLSSM ACLPYPSSLS TLEENPAAWV IPFIDETSSH  60
KRLKQQHSSS YEFNNAGTNY CSLYSGSGSM CARGLDSLPR IHFRDHISAY TRRYLAVEAM  120
EEATATLMRG KEGESEEGGR GDATKLVQQL IACAEAVACR DKAHASTLLY ELRANAKVFG  180
TSFQRVASCF VQGLSDRLAL IQPLGAVGLI GPITKSTAFS AEKDEALHLV YEICPQIQFG  240
HFVANASILE AFEGESSVHV IDLGMTLGLP HGYQWRNLID SLANRAGQPL HRLRITGVGN  300
SAERLQAIGN DLKLHAQSMK LNFEFSAVES SFENLKPQDF NLVDGDVLVV NSILQLHCLV  360
KESRGALNSV LQTLHQLSPK LMILVEQDTS HNGPFFLGRF MEALHNYSAI FDSLDAMLPK  420
YDTRRAKMEQ FYFGEEIKNI VSCEGPARVE RHERVEQWRR RMRRAGFQPA PLKMIAQAMK  480
WLEINTCEGY TVVEDKGCLV FGWKSKPIIA TSCWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-6215351426378Protein SCARECROW
5b3h_A2e-6215351425377Protein SCARECROW
5b3h_D2e-6215351425377Protein SCARECROW
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G237500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007227155.10.0DELLA protein RGL1
TrEMBLM5XQZ90.0M5XQZ9_PRUPE; Uncharacterized protein
STRINGEMJ283540.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87302945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-64RGA-like 1