PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pp3c9_14800V3.10.p | ||||||||
Common Name | HAP3B | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 219aa MW: 23775.6 Da PI: 6.396 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 188.1 | 6.2e-59 | 33 | 129 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 vreqdrflPianvsrimkk+lP+nakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyveplkvyl+kyr Pp3c9_14800V3.10.p 33 VREQDRFLPIANVSRIMKKALPSNAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMSTLGFEDYVEPLKVYLHKYR 123 69***************************************************************************************** PP NF-YB 92 elegek 97 elegek Pp3c9_14800V3.10.p 124 ELEGEK 129 ****97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.1E-56 | 29 | 144 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.43E-42 | 36 | 144 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.1E-28 | 39 | 103 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.5E-21 | 67 | 85 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 70 | 86 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.5E-21 | 86 | 104 | No hit | No description |
PRINTS | PR00615 | 1.5E-21 | 105 | 123 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 219 aa Download sequence Send to blast |
MADSYGHNAG SPESSPHSDN ESGGHYRDQD ASVREQDRFL PIANVSRIMK KALPSNAKIS 60 KDAKETVQEC VSEFISFITG EASDKCQREK RKTINGDDLL WAMSTLGFED YVEPLKVYLH 120 KYRELEGEKA STAKGGDQQG GKEGSQGVMG SMGMSGGMNG MNGTMNGNMH GHGIPVSMQM 180 LQQSYGQQAP PGMMYSPHQM MPQYQMPMQS GGNQPRGV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 1e-50 | 32 | 124 | 5 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ppa.8903 | 0.0 | gametophore| protonema |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024384928.1 | 1e-162 | nuclear transcription factor Y subunit B-3-like | ||||
Refseq | XP_024384929.1 | 1e-162 | nuclear transcription factor Y subunit B-3-like | ||||
Refseq | XP_024384930.1 | 1e-162 | nuclear transcription factor Y subunit B-3-like | ||||
Refseq | XP_024384931.1 | 1e-162 | nuclear transcription factor Y subunit B-3-like | ||||
Refseq | XP_024384932.1 | 1e-162 | nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | O23310 | 2e-72 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A0I9QQM2 | 1e-161 | A0A0I9QQM2_PHYPA; CCAAT-box binding factor HAP3-like protein | ||||
STRING | PP1S302_35V6.6 | 1e-161 | (Physcomitrella patens) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 4e-74 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pp3c9_14800V3.10.p |
Publications ? help Back to Top | |||
---|---|---|---|
|