PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pp3c4_350V3.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 52aa MW: 5975.99 Da PI: 9.7536 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 40.5 | 4.2e-13 | 5 | 50 | 227 | 273 |
GRAS 227 vLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273 +++l+++ls+k++++ q+++h ++ F+++f+eal+yy+alfdsle+ Pp3c4_350V3.1.p 5 TIRLIQKLSSKIITIRKQNLNH-KGLFFDKFVEALHYYAALFDSLEK 50 789*******************.88999*****************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 10.325 | 1 | 51 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 1.3E-10 | 5 | 50 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 52 aa Download sequence Send to blast |
CDFATIRLIQ KLSSKIITIR KQNLNHKGLF FDKFVEALHY YAALFDSLEK S* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | A0A2K1KLN6 | 1e-28 | A0A2K1KLN6_PHYPA; Uncharacterized protein (Fragment) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54220.1 | 1e-14 | GRAS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pp3c4_350V3.1.p |