PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pp3c3_25870V3.5.p | ||||||||
Common Name | PHYPADRAFT_224453 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 126aa MW: 13380.8 Da PI: 4.4853 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 34.9 | 3.8e-11 | 16 | 66 | 40 | 90 |
NF-YB 40 sefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 efi +++se+++ c +++++ti+++ +l al lGf +y+ ++++ +++ Pp3c3_25870V3.5.p 16 KEFINLISSESNEICSKDEKRTIAPEHVLRALEILGFGEYIGEVQAAYEQH 66 59***************************************9998766555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.6E-20 | 16 | 111 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 8.15E-18 | 16 | 111 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.6E-7 | 16 | 47 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000006 | anatomy | plant protoplast | ||||
PO:0025017 | anatomy | plant spore | ||||
PO:0030003 | anatomy | protonema | ||||
PO:0030018 | anatomy | gametophore |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
MDTAGSRPKD DVSLPKEFIN LISSESNEIC SKDEKRTIAP EHVLRALEIL GFGEYIGEVQ 60 AAYEQHKNES LESPKVGGRW AKEGGGGGMT EEEAIAAQQR MFAEARARMN SGGAAAPAAQ 120 ANDSD* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_B | 4e-23 | 12 | 106 | 43 | 133 | Transcription Regulator NC2 beta chain |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024369784.1 | 8e-87 | uncharacterized protein LOC112279508 isoform X2 | ||||
Swissprot | P49592 | 3e-42 | NC2B_ARATH; Protein Dr1 homolog | ||||
TrEMBL | A9TQH0 | 1e-63 | A9TQH0_PHYPA; Predicted protein | ||||
STRING | PP1S288_38V6.1 | 2e-64 | (Physcomitrella patens) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23090.3 | 1e-35 | nuclear factor Y, subunit B13 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pp3c3_25870V3.5.p |
Entrez Gene | 5944071 |
Publications ? help Back to Top | |||
---|---|---|---|
|