PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pp3c3_25870V3.3.p | ||||||||
Common Name | PHYPADRAFT_224453 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 156aa MW: 16693.8 Da PI: 4.5019 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 71.9 | 1e-22 | 10 | 96 | 4 | 90 |
NF-YB 4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 +d lP a +++i+k++lP + +++kda++++ ec +efi +++se+++ c +++++ti+++ +l al lGf +y+ ++++ +++ Pp3c3_25870V3.3.p 10 DDVSLPKATMTKIIKEMLPPDVRVAKDAQDLLVECCVEFINLISSESNEICSKDEKRTIAPEHVLRALEILGFGEYIGEVQAAYEQH 96 6889*************************************************************************9998765555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.2E-37 | 8 | 141 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.8E-33 | 10 | 141 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.3E-21 | 13 | 77 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000006 | anatomy | plant protoplast | ||||
PO:0025017 | anatomy | plant spore | ||||
PO:0030003 | anatomy | protonema | ||||
PO:0030018 | anatomy | gametophore |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 156 aa Download sequence Send to blast |
MDTAGSRPKD DVSLPKATMT KIIKEMLPPD VRVAKDAQDL LVECCVEFIN LISSESNEIC 60 SKDEKRTIAP EHVLRALEIL GFGEYIGEVQ AAYEQHKNES LESPKVGGRW AKEGGGGGMT 120 EEEAIAAQQR MFAEARARMN SGGAAAPAAQ ANDSD* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_B | 4e-39 | 10 | 136 | 12 | 133 | Transcription Regulator NC2 beta chain |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024369783.1 | 1e-110 | protein Dr1 homolog isoform X1 | ||||
Refseq | XP_024369785.1 | 1e-111 | protein Dr1 homolog isoform X3 | ||||
Refseq | XP_024369786.1 | 1e-111 | protein Dr1 homolog isoform X3 | ||||
Refseq | XP_024369787.1 | 1e-111 | protein Dr1 homolog isoform X3 | ||||
Swissprot | P49592 | 3e-71 | NC2B_ARATH; Protein Dr1 homolog | ||||
TrEMBL | A9TQH0 | 1e-110 | A9TQH0_PHYPA; Predicted protein | ||||
STRING | PP1S288_38V6.1 | 1e-111 | (Physcomitrella patens) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23090.4 | 3e-63 | nuclear factor Y, subunit B13 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pp3c3_25870V3.3.p |
Entrez Gene | 5944071 |
Publications ? help Back to Top | |||
---|---|---|---|
|