PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pp3c3_17650V3.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 175aa MW: 19759.8 Da PI: 4.7066 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 165.7 | 6e-52 | 2 | 96 | 8 | 102 |
NF-YC 8 kqiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 +++e+++dfk h+lPlarikki+k+dedvkmi+aeaPvl+skace+fileltlrsw+h+eenkrrtl+++dia a+tr difdflvdivprd Pp3c3_17650V3.2.p 2 QEMEQVNDFKTHQLPLARIKKIMKSDEDVKMIAAEAPVLFSKACEMFILELTLRSWIHTEENKRRTLQRNDIAGAITRGDIFDFLVDIVPRD 93 67****************************************************************************************** PP NF-YC 100 elk 102 elk Pp3c3_17650V3.2.p 94 ELK 96 975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 1.34E-30 | 2 | 86 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 4.3E-37 | 5 | 78 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.8E-21 | 14 | 77 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MQEMEQVNDF KTHQLPLARI KKIMKSDEDV KMIAAEAPVL FSKACEMFIL ELTLRSWIHT 60 EENKRRTLQR NDIAGAITRG DIFDFLVDIV PRDELKEEDL GVPWSGVPGI PAEGVQYGGM 120 YYPPMPGQPM HHPMGAPEMM VGQPGMPPNP QMMYQPPPAA FAPEQQQQQQ QQMQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 3e-52 | 1 | 92 | 4 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 64 | 70 | RRTLQRN |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ppa.12186 | 0.0 | gametophore| protonema| sporophyte |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. Present in etiolated seedlings. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:17322342, ECO:0000269|PubMed:9662544}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024369382.1 | 1e-125 | nuclear transcription factor Y subunit C-2-like | ||||
Swissprot | Q9SMP0 | 1e-64 | NFYC1_ARATH; Nuclear transcription factor Y subunit C-1 | ||||
TrEMBL | A0A2K1KUV7 | 1e-124 | A0A2K1KUV7_PHYPA; Uncharacterized protein | ||||
STRING | PP1S315_9V6.3 | 1e-124 | (Physcomitrella patens) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G56170.2 | 3e-60 | nuclear factor Y, subunit C2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pp3c3_17650V3.2.p |
Publications ? help Back to Top | |||
---|---|---|---|
|