PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c22_6370V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Nin-like
Protein Properties Length: 1263aa    MW: 135010 Da    PI: 7.4669
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c22_6370V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.52.7e-28777827252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ek+i l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Pp3c22_6370V3.1.p 777 EKTIGLNVLQQYFAGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 827
                        799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.608761847IPR003035RWP-RK domain
PfamPF020427.7E-25780827IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2401.7E-1911751257No hitNo description
SuperFamilySSF542775.56E-1911751257No hitNo description
SMARTSM006666.3E-1611781260IPR000270PB1 domain
PROSITE profilePS5174521.15411781260IPR000270PB1 domain
PfamPF005646.3E-1411791256IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1263 aa     Download sequence    Send to blast
MELLRSNPRC GPRTRRTTEC GGHGQQQATG ATRVVVAGGL GGGSAGEAKF VMDETVLMDL  60
MELDSLSEQL LGETWAGDNH GDYGSYLAYP ASCNGGMFAA AGPPPVSQSA QMYSYGNGSM  120
AASLQAFQQE LMLQQVVESC QQSIPVASSS PPSLPLSSAP VSGISSYGAA VGSRLLSSSS  180
PSPSGTARTM PGNQSLAGMI TGDGRGVGDP RGGVGGRSGV AEIRESGVVD REEEKSSLST  240
VEGNPVSSGN LEAGVRGPRI SAGFPLPLRD RMMQALRLIG RSLKDELVQV WMPVVQGTRK  300
CLMTRDQPFT VEPRNEQLWV YRSMSESYEF PAERVEGKVL GLPGRVFIGQ KVEWTPNVQY  360
YSIQEYLRVK EAQRCDIRGS LAVPVLDPVS HQCVAVIELV GRAEKVQYGP DVDIIARALQ  420
AVNLTCPVGL ETPPLERSSW GRQAALSEMA DVLKAVCEAH RLPFAQTWVP TCSYGSRSDA  480
KAQGNNAEQV NGRCSRSKVV LRTVDGDGPC YVSDSRMLGF RRACLEHVLE KGQGVPGKAM  540
LTNLPVFDSD VKSFSKDEYP LGHYAKLFGL VSAVAIRLRS VHSGDEDFIL EFFLPTDCVD  600
SEKQQVMLNS LSITMQRICQ SLRTLSEKEL EEERREALAE SMEMQAKAVK EEAKEVSNKE  660
DLLAAYGFNR HPGGGNGCEE TTQAFPQVLQ HHGVQQAAAR CAVQRPPLQQ FSRGMPTGRG  720
CEEGLRILES HVYPWHHHPE QMGLEHGLGT GGFGCSSLHQ DVASHRRRFE RRRGTTEKTI  780
GLNVLQQYFA GSLKDAAKSI GVCPTTLKRI CRQHGISRWP SRKINKVSRS LKKLQGVIDS  840
VQGAEGALRI NALTGDLSSA AVAAAAVNGH MNKDMAASSQ GNLSVSWSTP SLNSLDVKEA  900
HGKLGSAEPL LGPKEESRRR HDPCSPQKLL LSMLKPTLQF RPEDDRIVSS LEVNAMSGAS  960
GGHGRVQLDN GDICRSNDRS SVSNIGSNPN VKAAYGSNGG HCRPGMSPLA SGGILSSADT  1020
DRGCEGGHGG NRSSGNACQD VGNAGKVNGG GKGQQASPLG RPLEHLVPGR GGPGRPGDFI  1080
KAATSRGWNE SRVHGGGGAM AALKGVDQYA LYGPVDDPVS SCNHANGGED EVTGRPGLCS  1140
LDSPGFGSSP ASDCSSPSSG VNGTSNKKAW RGREDSAAIT VKVTYGLDTV RVKFAQNVSF  1200
VELKEEVGRR LKLAGQNFNL KYLDDDEEWM LLACDADLQE SIDLMRVSGR HAIKLMICSN  1260
ML*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.169500.0protonema
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024361103.10.0protein NLP1-like
TrEMBLA0A2K1IMF80.0A0A2K1IMF8_PHYPA; Uncharacterized protein
STRINGPP1S12_320V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.15e-89Nin-like family protein