PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c22_6360V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Nin-like
Protein Properties Length: 1212aa    MW: 129844 Da    PI: 7.1282
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c22_6360V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.52.6e-28726776252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ek+i l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Pp3c22_6360V3.1.p 726 EKTIGLNVLQQYFAGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 776
                        799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.608710796IPR003035RWP-RK domain
PfamPF020427.3E-25729776IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2401.6E-1911241206No hitNo description
SuperFamilySSF542775.23E-1911241206No hitNo description
PROSITE profilePS5174521.15411271209IPR000270PB1 domain
SMARTSM006666.3E-1611271209IPR000270PB1 domain
PfamPF005646.0E-1411281205IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1212 aa     Download sequence    Send to blast
MDETVLMDLM ELDSLSEQLL GETWAGDNHG DYGSYLAYPA SCNGGMFAAA GPPPVSQSAQ  60
MYSYGNGSMA ASLQAFQQEL MLQQVVESCQ QSIPVASSSP PSLPLSSAPV SGISSYGAAV  120
GSRLLSSSSP SPSGTARTMP GNQSLAGMIT GDGRGVGDPR GGVGGRSGVA EIRESGVVDR  180
EEEKSSLSTV EGNPVSSGNL EAGVRGPRIS AGFPLPLRDR MMQALRLIGR SLKDELVQVW  240
MPVVQGTRKC LMTRDQPFTV EPRNEQLWVY RSMSESYEFP AERVEGKVLG LPGRVFIGQK  300
VEWTPNVQYY SIQEYLRVKE AQRCDIRGSL AVPVLDPVSH QCVAVIELVG RAEKVQYGPD  360
VDIIARALQA VNLTCPVGLE TPPLERSSWG RQAALSEMAD VLKAVCEAHR LPFAQTWVPT  420
CSYGSRSDAK AQGNNAEQVN GRCSRSKVVL RTVDGDGPCY VSDSRMLGFR RACLEHVLEK  480
GQGVPGKAML TNLPVFDSDV KSFSKDEYPL GHYAKLFGLV SAVAIRLRSV HSGDEDFILE  540
FFLPTDCVDS EKQQVMLNSL SITMQRICQS LRTLSEKELE EERREALAES MEMQAKAVKE  600
EAKEVSNKED LLAAYGFNRH PGGGNGCEET TQAFPQVLQH HGVQQAAARC AVQRPPLQQF  660
SRGMPTGRGC EEGLRILESH VYPWHHHPEQ MGLEHGLGTG GFGCSSLHQD VASHRRRFER  720
RRGTTEKTIG LNVLQQYFAG SLKDAAKSIG VCPTTLKRIC RQHGISRWPS RKINKVSRSL  780
KKLQGVIDSV QGAEGALRIN ALTGDLSSAA VAAAAVNGHM NKDMAASSQG NLSVSWSTPS  840
LNSLDVKEAH GKLGSAEPLL GPKEESRRRH DPCSPQKLLL SMLKPTLQFR PEDDRIVSSL  900
EVNAMSGASG GHGRVQLDNG DICRSNDRSS VSNIGSNPNV KAAYGSNGGH CRPGMSPLAS  960
GGILSSADTD RGCEGGHGGN RSSGNACQDV GNAGKVNGGG KGQQASPLGR PLEHLVPGRG  1020
GPGRPGDFIK AATSRGWNES RVHGGGGAMA ALKGVDQYAL YGPVDDPVSS CNHANGGEDE  1080
VTGRPGLCSL DSPGFGSSPA SDCSSPSSGV NGTSNKKAWR GREDSAAITV KVTYGLDTVR  1140
VKFAQNVSFV ELKEEVGRRL KLAGQNFNLK YLDDDEEWML LACDADLQES IDLMRVSGRH  1200
AIKLMICSNM L*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.169500.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024361103.10.0protein NLP1-like
RefseqXP_024361132.10.0protein NLP2-like
TrEMBLA0A2K1IMF80.0A0A2K1IMF8_PHYPA; Uncharacterized protein
TrEMBLA0A2K1IMH20.0A0A2K1IMH2_PHYPA; Uncharacterized protein
STRINGPP1S12_321V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.13e-89Nin-like family protein