PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c17_4375V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Nin-like
Protein Properties Length: 1252aa    MW: 135592 Da    PI: 5.5652
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c17_4375V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.52.7e-28780830252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ek+i l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Pp3c17_4375V3.1.p 780 EKTIGLDVLQQYFAGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 830
                        799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.075764850IPR003035RWP-RK domain
PfamPF020425.6E-25783830IPR003035RWP-RK domain
SuperFamilySSF542777.85E-2211411232No hitNo description
PROSITE profilePS5174524.15511471229IPR000270PB1 domain
SMARTSM006661.0E-1611471229IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.1E-1811481228No hitNo description
CDDcd064074.40E-3711481228No hitNo description
PfamPF005643.6E-1611481228IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1252 aa     Download sequence    Send to blast
MEIPPPNERF QPTMPRWRTS ELLALSQQLS PGGQFPGSDS KFLIDDTLLS DLMDLDPLCD  60
QSGEPWVAAG QDFSLPFAAF SPGQFSPGNF SPSAMSPQPQ SQASPNSQLY AQVNSGMAVP  120
GGHLSPREIL VQDGGLTPSP SRLVDLLEQP STSEGYLVAM SPGTSANFAE MSQIYLSNGS  180
TANSHANLHS NSHGAMVNER VINLGNNRSN YGRNCLTVTN ATMERNPEGE SLLRQAELRD  240
EYAGQPMDPA AFEYINATQD AQYDMVTKSE TSKKRLVVTG GSLTLKERIT QALRFIGRSC  300
VDVLAQVWMP VRTADNQTVL STREQPFVLE RKTDRMWTYR SISENYVFAV TGGFPGLPGR  360
VYLQQVPEWT PNVQFYSDHE YLRVKHAMAC DVKGTLAVPV FEASSRNCLA VIELVMKAEK  420
VQYAPEIDII CRALQAVNLS CTDGMELPAL EFRTQGRRAA LAEISEVLTA VCETHNLPLA  480
QTWVPGSHHS VDKPSSNKKC RVESGTNSKS SGGSHSSNRV CLCTGDGPHY VKDSKMWGFR  540
QACLEHYLEK GQGVPGKAFA SNQPAFESDV KNYSKIEYPL GHYAQLFGLT AAVAIRLRSI  600
HTGADDFVLE FFLPVKCISS DDQQVMLNSL SITMQRVCRS LRTVTDKELA DELKAASAEE  660
STEAESNPPK PVDPAEEQRN AAASGIELPP SENATENPTV QEKQPQQISQ EIPALPLERS  720
QSLVSEKAQV GESNDNVEPL QLFEKQPAIQ VPGAARTFTS TAQKAANQNR RLDRRRGTTE  780
KTIGLDVLQQ YFAGSLKDAA KSIGVCPTTL KRICRQHGIS RWPSRKINKV SRSLKKLQGV  840
IESVQGADGT LRINAFSGDI ASAAVAAAAV TSTVPAAKDT TTEDGRSAAS PSEACHNQHD  900
GISNGESNQT PLSVEDEDSS PHDIQRLRHP TGASNLSMAR AEPKVPVNLA NANGTRPSLP  960
IDHTRDRNSD ESSGGAEFGS TNHGGADQDF YAVSAEQESD GTGRKLDIKE VSAKDPPTLY  1020
IPNGSSNPSH SGGSDWDRSP NGSMSDFGRN TDSGSGTGFN GGAICVESRV HGGASALAAL  1080
RDSDLSSYGN PCDYERYALD DSPREVTGAH RTGSSHHNGS DSSSPSSGAG GYARKHYWPV  1140
PVVEPEAVTV KATFRADTVR FKLLVGSGYL DLRNEISRRL KVDEHGFDLK YLDDEEEWML  1200
ITCDADVKEC IDVAQTLGRH TVKLMVRQSG SWTSSGNNSN VSLQDMNCHA A*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.178070.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024400585.10.0protein NLP6-like
TrEMBLA0A2K1J2N50.0A0A2K1J2N5_PHYPA; Uncharacterized protein
STRINGPP1S26_246V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.11e-143Nin-like family protein