PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c15_9180V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Nin-like
Protein Properties Length: 1163aa    MW: 126230 Da    PI: 5.5659
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c15_9180V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.21.6e-28716766252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ek+i l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Pp3c15_9180V3.1.p 716 EKTIGLSVLQQYFAGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 766
                        799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.995698786IPR003035RWP-RK domain
PfamPF020423.9E-25719766IPR003035RWP-RK domain
SuperFamilySSF542771.28E-2210531147No hitNo description
SMARTSM006662.4E-1410641146IPR000270PB1 domain
PROSITE profilePS5174522.61810641146IPR000270PB1 domain
PfamPF005643.0E-1410651143IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.8E-2110651144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1163 aa     Download sequence    Send to blast
MPPSEREVAM GISTGDIVSK FVVDDGLLSD FMDLDSLSDQ LDEEESWMDG ASGSSSCDFT  60
LTPYSMASSD NCYASFSPPS PVTSHSSSLY SSQTPSAAGL DGLQLLQQVL DGAPSAFPPP  120
LSPSPVGSGN IDMLLSDQNL SSMENVVDYN DLFEKSRVNS SFLAMPSEDD EDEAEEKSGL  180
SEEEKVVGEG ETRKRTLTRA LSSPPMSFRD RLLQAVRYIG RLRMDVLVQV WMPVVQQTSS  240
SSSKRVLITR DQPFVLEQKN DKLSNFRSAS EDYEFAADAG ITGMGLPGRV FVHQMPEWSP  300
NVQMYNCQEY LRHVEAQRCD VRGSLALPIM DPVSSQCVAV IELVGCTEKI QFHSDVDIVS  360
RAVQAVHLST VNSLETPVPE RLSQGRQAVL NEIAEVLTAV CETHKLPLAQ TWVPTYRYGS  420
MDIKVHQSGS KRMRSENGSG LSRNTSSSPC SGEILRTGDG PCYVSDGRIW GFRRACLEHS  480
LEKGQGVAGK AFETNQPNFD SDVKIHCKTE YPLAHHAKCF GLGAAVAIRL RSIRTGNDDF  540
ILEFFLPSTC VESKEQQLLL NSLSITMQRT CRSLRTITDE EEKEELHIAG NGNVLVKAEA  600
KEEPIDGDCV FHPRTPYGSQ EGISLISSGA KGEEQATHCQ LPHPSLISQL SLQRNSNWQS  660
SYLLNPSESQ QHASKSEDSD PLVNHVLGLD RLGCSNAAQV AASQRRKLDR RRGTTEKTIG  720
LSVLQQYFAG SLKDAAKSIG VCPTTLKRIC RQHGISRWPS RKINKVSRSL KKLQGVIDSV  780
QGADGALRIN ALTGDITTAS MAADNGSGHA GSDGSCAKSK WSVSWSTPAP RNRDLEDHKV  840
RGGTLLLPKE EDRKKHDSCS PQSVLMSILS SPETKPSRHW HTNEKSAGVS AEGNDLAVGH  900
DSGFRGASTL SPGSNLTIDT GLAVVCDAVT AHHDLLGARS QQSSPSSGSY DDIAPPTSKV  960
DSRGSGLPES KTGSGCQNQV HDSASAEVAI KDVCKKNKSP EVGVSSSSLN EDQEQEREVM  1020
GGSGTSNSPR FGSSTAQGTS DCSSPSSAGN PSSHMKTWPA HSDVITMKVT YNEDTVRFKL  1080
SSDKSYLDLR DQVNRRLKLA GLKFDLKYLD DDEEWMLLAC DADLQECLEV MRVSRRNAVK  1140
LMVRCNVSSS VETSCADDKT LS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.180140.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024397373.10.0protein NLP1-like isoform X1
TrEMBLA0A2K1JCK30.0A0A2K1JCK3_PHYPA; Uncharacterized protein
STRINGPP1S250_18V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.11e-130Nin-like family protein