PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pp3c12_3580V3.1.p | ||||||||
Common Name | HAP3C | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 219aa MW: 23914.6 Da PI: 6.4186 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 188.4 | 5.2e-59 | 34 | 130 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 vreqdrflPianvsrimkk+lP+nakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyveplkvyl+kyre Pp3c12_3580V3.1.p 34 VREQDRFLPIANVSRIMKKALPSNAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMSTLGFEDYVEPLKVYLHKYRE 125 69****************************************************************************************** PP NF-YB 93 legek 97 legek Pp3c12_3580V3.1.p 126 LEGEK 130 ***97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.5E-56 | 30 | 149 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.57E-42 | 37 | 147 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.1E-28 | 40 | 104 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.5E-21 | 68 | 86 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 71 | 87 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.5E-21 | 87 | 105 | No hit | No description |
PRINTS | PR00615 | 1.5E-21 | 106 | 124 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 219 aa Download sequence Send to blast |
MADSYGHNPG SPENDPHSDN ESGGGHYRDH DASVREQDRF LPIANVSRIM KKALPSNAKI 60 SKDAKETVQE CVSEFISFIT GEASDKCQRE KRKTINGDDL LWAMSTLGFE DYVEPLKVYL 120 HKYRELEGEK TSVTKGGDHS AGKESNQSNQ GGIGSLGMPG GMIGMNGSMH QQGIPVSMQM 180 MQQSYGHQSP LGMMFAPHQT IPQYQMSMQS GSNQSRGL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 3e-50 | 33 | 125 | 5 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU019897 | 1e-143 | EU019897.1 Physcomitrella patens CCAAT-box binding factor HAP3-like protein (HAP3C) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024391790.1 | 1e-163 | nuclear transcription factor Y subunit B-3-like | ||||
Refseq | XP_024391791.1 | 1e-163 | nuclear transcription factor Y subunit B-3-like | ||||
Refseq | XP_024391792.1 | 1e-163 | nuclear transcription factor Y subunit B-3-like | ||||
Refseq | XP_024391794.1 | 1e-163 | nuclear transcription factor Y subunit B-3-like | ||||
Refseq | XP_024391795.1 | 1e-163 | nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | O23310 | 2e-69 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A0I9QPN3 | 1e-162 | A0A0I9QPN3_PHYPA; CCAAT-box binding factor HAP3-like protein | ||||
STRING | PP1S462_7V6.1 | 1e-162 | (Physcomitrella patens) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 6e-72 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pp3c12_3580V3.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|