PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_016652160.1

Organism

Prunus mume

Taxonomic ID

102107

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus

Family

YABBY

Protein Properties

Length: 166aa MW: 17966.1 Da PI: 8.6073

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_016652160.1	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	114.3	2.1e-35	19	144	24	163
YABBY 24 vsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevprvppvirP 118 v +P++ l+ +vtv+CGhC++l ++ + a q + ++h l ++ + s k +s+s+s + +++ ++p++p v++P XP_016652160.1 19 VGLPFKRLLDTVTVKCGHCSNLSFLSTRPALQGQCLSDH---------PTSLTLQQAGCCSDFRKGQSSSSSSPI-----SSEPSSPKAPFVVKP 99 789****************988777777777776666.........233333333333333333333333333.....4566889999* PP YABBY 119 PekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163 Pek+ r Psaynrf+keeiqrika+nP+i hreafsaaaknWa + XP_016652160.1 100 PEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY 144 *****************************************76 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	8.7E-42	19	144	IPR006780	YABBY protein
SuperFamily	SSF47095	6.41E-9	88	142	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	3.2E-5	98	143	IPR009071	High mobility group box domain
CDD	cd01390	2.94E-6	105	141	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010254	Biological Process	nectary development
GO:0010582	Biological Process	floral meristem determinacy
GO:0048479	Biological Process	style development

Sequence ? help Back to Top
Protein Sequence Length: 166 aa Download sequence Send to blast
MQLSAAASRS STYDDDDFVG LPFKRLLDTV TVKCGHCSNL SFLSTRPALQ GQCLSDHPTS 60 LTLQQAGCCS DFRKGQSSSS SSPISSEPSS PKAPFVVKPP EKKHRLPSAY NRFMKEEIQR 120 IKAANPEIPH REAFSAAAKN WARYIPSPSA GSDSGSCSST NNILQE

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for the initiation of nectary development. Also involved in suppressing early radial growth of the gynoecium, in promoting its later elongation and in fusion of its carpels by regulating both cell division and expansion. Establishes the polar differentiation in the carpels by specifying abaxial cell fate in the ovary wall. Regulates both cell division and expansion. {ECO:0000269\|PubMed:10225997, ECO:0000269\|PubMed:10225998, ECO:0000269\|PubMed:10535738, ECO:0000269\|PubMed:11714690, ECO:0000269\|PubMed:15598802, ECO:0000269\|Ref.10}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00220	DAP	Transfer from AT1G69180	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_016652160.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by SPT and by A class genes AP2 and LUG in the outer whorl. In the third whorl, B class genes AP3 and PI, and the C class gene AG act redundantly with each other and in combination with SEP1, SEP2, SEP3, SHP1 and SHP2 to activate CRC in nectaries and carpels. LFY enhances its expression. {ECO:0000269\|PubMed:10225998, ECO:0000269\|PubMed:15598802}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB627250	1e-130	AB627250.1 Malus x domestica mRNA, microsatellite: MEST098, clone: FLW01_10_E08.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016652160.1	1e-120	PREDICTED: protein CRABS CLAW isoform X4
Swissprot	Q8L925	5e-51	CRC_ARATH; Protein CRABS CLAW
TrEMBL	A0A251R4X7	1e-103	A0A251R4X7_PRUPE; Uncharacterized protein
STRING	EMJ25198	1e-101	(Prunus persica)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69180.1	7e-51	YABBY family protein

Publications ? help Back to Top
Fourquin C,Primo A,Martínez-Fernández I,Huet-Trujillo E,Ferrándiz C The CRC orthologue from Pisum sativum shows conserved functions in carpel morphogenesis and vascular development. Ann. Bot., 2014. 114(7): p. 1535-44 [PMID:24989787] Pfannebecker KC,Lange M,Rupp O,Becker A Seed Plant-Specific Gene Lineages Involved in Carpel Development. Mol. Biol. Evol., 2017. 34(4): p. 925-942 [PMID:28087776] Yamaguchi N,Huang J,Xu Y,Tanoi K,Ito T Fine-tuning of auxin homeostasis governs the transition from floral stem cell maintenance to gynoecium formation. Nat Commun, 2017. 8(1): p. 1125 [PMID:29066759] Yamaguchi N, et al. Chromatin-mediated feed-forward auxin biosynthesis in floral meristem determinacy. Nat Commun, 2018. 9(1): p. 5290 [PMID:30538233]