PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016648444.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family STAT
Protein Properties Length: 639aa    MW: 71547.3 Da    PI: 6.4735
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016648444.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT194.11.4e-601682891122
            STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkky 95 
                     ldvvll+a+++p++k++ev+asL+yad+g++vek++d eapLL+s dGvef+s drp+k+l+G+asfklkisqLsskcdnr+f+i+f++pkl++y
  XP_016648444.1 168 LDVVLLDAFSHPINKELEVIASLVYADNGAPVEKTSDGEAPLLASQDGVEFASCDRPSKMLHGHASFKLKISQLSSKCDNRMFHIMFHMPKLETY 262
                     8********************************************************************************************** PP

            STAT  96 pfleavskpirCisrsrntrsssltkk 122
                     pfl+a+s pirCisr+r+tr ss+ +k
  XP_016648444.1 263 PFLKAFSPPIRCISRNRSTRISSRLWK 289
                     ********************9998886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.505.105.6E-8533624IPR000980SH2 domain
SuperFamilySSF555507.94E-8537612IPR000980SH2 domain
PROSITE profilePS5000110.404541623IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 639 aa     Download sequence    Send to blast
MEGAPFLVLS EKKKMVLLPL SILHKEAPET CDLTSLSEVP HVAMETEFPM EKWIHIGCEV  60
SSDFVLLHID GEIAGKKAMS SLFNKDSISS GLTKMTLVCG GGDDNSLQGY VHNHKVLPLT  120
SSIMEYYAKD PPLQLSIDNS SASEIEEGSD GVWSIVGGKA SCRRIFSLDV VLLDAFSHPI  180
NKELEVIASL VYADNGAPVE KTSDGEAPLL ASQDGVEFAS CDRPSKMLHG HASFKLKISQ  240
LSSKCDNRMF HIMFHMPKLE TYPFLKAFSP PIRCISRNRS TRISSRLWKR PASANDQLNL  300
SQLSGLDDET LELHHSSIHE EKLSPSSKRC RLGQDDECNS HSRTANQVKN VVRRSDSLEE  360
LDVSQTDSES PEARNSALKS TSSSRNPMSD ATIFKYCLAG LTEKTLLLKE ISSTGSNEEL  420
LSFSHQVSLY SGCSHHRHQI AMAKRLIEEG NKAWNLISQN KHQVPWESVV FEIEEQFMKI  480
ACCNSRALTQ QDFELLRRIA GCQEYLAQEN FEKMWCWLYP VALMLSKDWI NTMWSSTSPK  540
WIEGFITKEE AETSLQGSRG LQESGTFVLR FPTSRSWPHP DAGSLVVTYV SSKHAIHNKL  600
ISLDQMFSSA EREKNAKSLQ DMLLAEPELS RLGRIIRSR
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_016648444.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016648444.10.0PREDICTED: uncharacterized protein LOC103325950
SwissprotQ56XZ10.0SHB_ARATH; SH2 domain-containing protein B
TrEMBLA0A251PL130.0A0A251PL13_PRUPE; Uncharacterized protein
STRINGXP_008226365.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67103036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B
Publications ? help Back to Top
  1. Yamada Y,Wang HY,Fukuzawa M,Barton GJ,Williams JG
    A new family of transcription factors.
    Development, 2008. 135(18): p. 3093-101
    [PMID:18701541]