PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_008239414.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 125aa MW: 13437.7 Da PI: 4.8897 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 107.7 | 7.1e-34 | 13 | 75 | 36 | 98 |
NF-YB 36 qecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegekk 98 +e efisf+tseasdkcqrekrktingddllwa+atlGfedy++plkvyl++yre+eg++k XP_008239414.2 13 HESGGEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKVYLTRYREMEGDTK 75 67788*******************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PRINTS | PR00615 | 4.6E-18 | 12 | 30 | No hit | No description |
Gene3D | G3DSA:1.10.20.10 | 3.2E-30 | 15 | 95 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.66E-23 | 17 | 86 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.0E-10 | 18 | 48 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.6E-18 | 31 | 49 | No hit | No description |
PRINTS | PR00615 | 4.6E-18 | 50 | 68 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 125 aa Download sequence Send to blast |
MAEAPGSPGG GSHESGGEFI SFITSEASDK CQREKRKTIN GDDLLWAMAT LGFEDYIDPL 60 KVYLTRYREM EGDTKGSGKG GDSSSKKDAQ PSSNAQISRQ GSFSQGGNYS NSQSQHMMVP 120 MQGTE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-24 | 13 | 69 | 36 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-24 | 13 | 69 | 36 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_008239414.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008239414.2 | 1e-88 | PREDICTED: nuclear transcription factor Y subunit B-10 | ||||
Swissprot | Q67XJ2 | 6e-57 | NFYBA_ARATH; Nuclear transcription factor Y subunit B-10 | ||||
TrEMBL | A0A2P5FUZ0 | 2e-69 | A0A2P5FUZ0_TREOI; Nuclear transcription factor Y subunit B | ||||
STRING | XP_008239414.1 | 2e-74 | (Prunus mume) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2545 | 33 | 82 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 7e-41 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|