PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_008233563.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 121aa MW: 13397.3 Da PI: 8.2249 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 92.7 | 3.5e-29 | 1 | 57 | 17 | 73 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalat 73 mkk lP+nakisk+aketvqecv efisfvt++as kcqrekrktingddl wa+ t XP_008233563.2 1 MKKSLPSNAKISKEAKETVQECVPEFISFVTGKASYKCQREKRKTINGDDLPWAMKT 57 9******************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.5E-25 | 1 | 57 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.43E-19 | 1 | 59 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.9E-19 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.0E-8 | 19 | 37 | No hit | No description |
PRINTS | PR00615 | 2.0E-8 | 38 | 56 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MKKSLPSNAK ISKEAKETVQ ECVPEFISFV TGKASYKCQR EKRKTINGDD LPWAMKTTSR 60 STEAQGGAAA PPLAGNFQTL EDLQIQPAYV QTFQGPPHGI QVFELFITGL NYLSVLMLDH 120 H |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-21 | 1 | 55 | 17 | 71 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-21 | 1 | 55 | 17 | 71 | Transcription factor HapC (Eurofung) |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_008233563.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008233563.2 | 1e-87 | PREDICTED: uncharacterized protein LOC103332591 | ||||
TrEMBL | A0A2I4DL24 | 1e-27 | A0A2I4DL24_JUGRE; nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
STRING | XP_008233563.1 | 5e-70 | (Prunus mume) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 8e-31 | nuclear factor Y, subunit B3 |