PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_008230765.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 92aa MW: 9876.99 Da PI: 8.0522 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 105.4 | 3.6e-33 | 23 | 80 | 2 | 59 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 ++vrY eC+kNhAa +Gg+avDGC+Efm+s+geegt+aal+CaACgCHRnFHRreve+ XP_008230765.1 23 RSVRYGECQKNHAAGVGGYAVDGCREFMASNGEEGTTAALTCAACGCHRNFHRREVET 80 579****************************************************875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 2.0E-20 | 1 | 87 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 8.5E-30 | 25 | 78 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 4.2E-28 | 26 | 78 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 24.958 | 27 | 77 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 92 aa Download sequence Send to blast |
MRKRQVVVRR SEEGSATSSF TMRSVRYGEC QKNHAAGVGG YAVDGCREFM ASNGEEGTTA 60 ALTCAACGCH RNFHRREVET VCECPSPSAN GA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_008230765.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007215197.1 | 2e-61 | mini zinc finger protein 2 | ||||
Refseq | XP_008230765.1 | 2e-61 | PREDICTED: mini zinc finger protein 2 | ||||
Refseq | XP_021818945.1 | 2e-61 | mini zinc finger protein 2-like | ||||
Swissprot | Q9LJW5 | 3e-41 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | A0A314UQ09 | 5e-60 | A0A314UQ09_PRUYE; Mini zinc finger protein 2 | ||||
TrEMBL | M5WT34 | 5e-60 | M5WT34_PRUPE; Uncharacterized protein | ||||
STRING | XP_008230765.1 | 8e-61 | (Prunus mume) | ||||
STRING | EMJ16396 | 8e-61 | (Prunus persica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1550 | 34 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 1e-29 | mini zinc finger 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|