PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_008226482.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 162aa MW: 18454.6 Da PI: 9.1067 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 132.8 | 1.2e-41 | 65 | 141 | 1 | 77 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 +Cq+e+C ad+ eak+y+rrhkvCe+hskapvv+vsgl+qrfCqqCsrfhel+efDe+krsCrrrLa+hnerrrk++ XP_008226482.1 65 CCQAERCGADFVEAKRYYRRHKVCEFHSKAPVVMVSGLRQRFCQQCSRFHELTEFDEAKRSCRRRLAGHNERRRKSS 141 6**************************************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 4.4E-60 | 3 | 152 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 8.7E-35 | 58 | 127 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.889 | 63 | 140 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.29E-38 | 63 | 143 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.0E-31 | 66 | 139 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MEAKSFEGRQ SWKEKVNKDV VDEVEDDSEE EEAGGGLMLR YEENEKQKKA GRRGSGGGGG 60 ASPPCCQAER CGADFVEAKR YYRRHKVCEF HSKAPVVMVS GLRQRFCQQC SRFHELTEFD 120 EAKRSCRRRL AGHNERRRKS SGEPYGEGSS RRGVASKQFQ IR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 3e-37 | 56 | 139 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_008226482.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040, ECO:0000305|PubMed:16914499}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008226482.1 | 1e-114 | PREDICTED: squamosa promoter-binding-like protein 3 | ||||
Swissprot | Q9S7A9 | 3e-44 | SPL4_ARATH; Squamosa promoter-binding-like protein 4 | ||||
TrEMBL | M5WZC7 | 1e-111 | M5WZC7_PRUPE; Squamosa promoter-binding-like protein | ||||
STRING | XP_008226482.1 | 1e-114 | (Prunus mume) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF535 | 34 | 153 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15270.1 | 2e-45 | squamosa promoter binding protein-like 5 |