PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_008223170.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 167aa MW: 18773.7 Da PI: 6.5208 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 165.2 | 8.7e-52 | 23 | 119 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 ++eqd++lPianv+rimk++lP nakisk+aket+qecvsefisfvtseas+kc++e+rkt+ngdd+ wal+ lGf+dy +pl+ +l++yre eg XP_008223170.1 23 MKEQDQLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTSEASEKCRKERRKTVNGDDVSWALGALGFDDYTAPLRRFLHRYREKEG 117 589*******************************************************************************************9 PP NF-YB 96 ek 97 e+ XP_008223170.1 118 ER 119 86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.2E-51 | 18 | 143 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.27E-38 | 26 | 145 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.1E-27 | 29 | 93 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 8.4E-16 | 57 | 75 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 60 | 76 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 8.4E-16 | 76 | 94 | No hit | No description |
PRINTS | PR00615 | 8.4E-16 | 95 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MVDNNNNIGA SGAANHDEDG AMMKEQDQLL PIANVGRIMK QILPPNAKIS KEAKETMQEC 60 VSEFISFVTS EASEKCRKER RKTVNGDDVS WALGALGFDD YTAPLRRFLH RYREKEGERI 120 SSSANNNNEN NQDKANNNTE DQQQRILLNH PHIQRPNFNK GSSTTGL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 5e-43 | 23 | 114 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 5e-43 | 23 | 114 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_008223170.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008223170.1 | 1e-123 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 3e-54 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A314ZLY3 | 1e-93 | A0A314ZLY3_PRUYE; Nuclear transcription factor Y subunit B-5-like | ||||
STRING | XP_008223170.1 | 1e-122 | (Prunus mume) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF805 | 32 | 131 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 4e-56 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|