PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00057188-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 66aa MW: 7417.66 Da PI: 10.682 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 96.7 | 9.9e-31 | 2 | 50 | 3 | 51 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ien++nrqvtfskRr g+lKKA+ELS+LC+aeva+iifsstgkl+e+ss PSME_00057188-RA 2 IENTTNRQVTFSKRRGGLLKKAKELSILCNAEVALIIFSSTGKLHEWSS 50 9**********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.5E-27 | 1 | 51 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 26.506 | 1 | 52 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 7.19E-27 | 2 | 60 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.1E-27 | 2 | 48 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.6E-16 | 14 | 29 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.6E-16 | 29 | 50 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 66 aa Download sequence Send to blast |
MIENTTNRQV TFSKRRGGLL KKAKELSILC NAEVALIIFS STGKLHEWSS SRLVSLANFY 60 FVTTIP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14. Directly suppresses D14 expression to control the outgrowth of axillary buds. {ECO:0000269|PubMed:23463009}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF120097 | 6e-50 | AF120097.1 Pinus radiata DEF/GLO-like protein (PrDGL) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020180450.1 | 1e-23 | MADS-box transcription factor 57-like | ||||
Refseq | XP_020180451.1 | 1e-23 | MADS-box transcription factor 57-like | ||||
Swissprot | Q6Z6W2 | 2e-21 | MAD57_ORYSJ; MADS-box transcription factor 57 | ||||
TrEMBL | A0A455R1Q0 | 5e-26 | A0A455R1Q0_9SPER; GLOBOSA/PISTILLATA-like MADS-box protein | ||||
STRING | Traes_6AL_B5D4C3A49.1 | 1e-24 | (Triticum aestivum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51870.2 | 6e-24 | AGAMOUS-like 71 |
Publications ? help Back to Top | |||
---|---|---|---|
|