PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00055566-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 98aa MW: 11169.7 Da PI: 4.2346 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 104.5 | 7.2e-33 | 1 | 65 | 38 | 102 |
NF-YC 38 misaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdelk 102 misaeaPvl+skacelfileltlrswlh+eenkrrtl+++dia a++r d+ dfl+divprde+k PSME_00055566-RA 1 MISAEAPVLFSKACELFILELTLRSWLHTEENKRRTLQRNDIAGAISRGDVLDFLLDIVPRDEVK 65 8*************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.4E-24 | 1 | 61 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 6.54E-19 | 1 | 61 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.7E-10 | 2 | 46 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 98 aa Download sequence Send to blast |
MISAEAPVLF SKACELFILE LTLRSWLHTE ENKRRTLQRN DIAGAISRGD VLDFLLDIVP 60 RDEVKEVDNG CTDYLPDTPD GFVEERRIPE KDSPPVEL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 8e-32 | 1 | 61 | 35 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 33 | 39 | RRTLQRN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF085083 | 4e-89 | EF085083.1 Picea sitchensis clone WS0296_J03 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024369382.1 | 9e-38 | nuclear transcription factor Y subunit C-2-like | ||||
Swissprot | Q8LCG7 | 1e-35 | NFYC2_ARATH; Nuclear transcription factor Y subunit C-2 | ||||
TrEMBL | A9NUT0 | 1e-38 | A9NUT0_PICSI; Uncharacterized protein | ||||
STRING | PP1S315_9V6.3 | 4e-37 | (Physcomitrella patens) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G56170.2 | 5e-38 | nuclear factor Y, subunit C2 |
Publications ? help Back to Top | |||
---|---|---|---|
|