PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PSME_00053929-RA

Organism

Pseudotsuga menziesii

Taxonomic ID

3357

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

NAC

Protein Properties

Length: 162aa MW: 18724.7 Da PI: 10.1801

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00053929-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	155.6	2.1e-48	10	136	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 ppGfrF Ptdeelvv+yL+kk++++ + + +i evd+yk++ w+Lp k+ +ekewyfF++rd++y++g+r++ra++sgyWkat dk++ + PSME_00053929-RA 10 PPGFRFFPTDEELVVHYLCKKAASQIILV-PIIVEVDLYKYDLWKLPDKALFGEKEWYFFTPRDRNYPNGSRPKRAASSGYWKATSVDKTINA 101 9*********************99888.78***********8777899*********************************** PP NAM 95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128 k +++ vg+kk Lvfy g+apkg+kt+W+mhey+l PSME_00053929-RA 102 KgGKKRVGIKKALVFYAGKAPKGSKTNWIMHEYHL 136 966777**************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.06E-53	6	138	IPR003441	NAC domain
PROSITE profile	PS51005	50.15	9	161	IPR003441	NAC domain
Pfam	PF02365	5.6E-27	10	136	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 162 aa Download sequence Send to blast
MDCHEHNQWP PGFRFFPTDE ELVVHYLCKK AASQIILVPI IVEVDLYKYD LWKLPDKALF 60 GEKEWYFFTP RDRNYPNGSR PKRAASSGYW KATSVDKTIN AKGGKKRVGI KKALVFYAGK 120 APKGSKTNWI MHEYHLADVS RPVRKKGSLR VSWSISSLLC FE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-66	10	151	18	154	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-66	10	151	18	154	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-66	10	151	18	154	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-66	10	151	18	154	NO APICAL MERISTEM PROTEIN
4dul_A	1e-66	10	151	18	154	NAC domain-containing protein 19
4dul_B	1e-66	10	151	18	154	NAC domain-containing protein 19
Search in ModeBase

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021284421.1	1e-74	NAC domain-containing protein 2-like
Swissprot	Q39013	4e-72	NAC2_ARATH; NAC domain-containing protein 2
TrEMBL	A0A0D6R3P9	5e-83	A0A0D6R3P9_ARACU; Uncharacterized protein
STRING	Gorai.010G051900.1	4e-73	(Gossypium raimondii)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	1e-74	NAC family protein

Publications ? help Back to Top
Florentin A,Damri M,Grafi G Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization. Dev. Dyn., 2013. 242(10): p. 1121-33 [PMID:23798027] Jensen MK, et al. ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana. FEBS Open Bio, 2013. 3: p. 321-7 [PMID:23951554] Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Yang X, et al. Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis. Plant Cell Rep., 2015. 34(6): p. 943-58 [PMID:25666276] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Liu Y,Sun J,Wu Y Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice. J. Plant Res., 2016. 129(5): p. 955-962 [PMID:27216423] Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining. PLoS ONE, 2016. 11(9): p. e0162327 [PMID:27618630] Zhao J,Missihoun TD,Bartels D The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana. Planta, 2018. 248(4): p. 1017-1027 [PMID:30027414]