PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00052727-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 122aa MW: 14243.4 Da PI: 10.237 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 61 | 2.5e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd++l ++v+++G g W +++++ g++R++k+c++rw++yl PSME_00052727-RA 14 RGAWTAEEDLILCEYVRLHGDGGWQKVPQKAGLKRCGKSCRLRWRNYL 61 89*********************************************7 PP | |||||||
2 | Myb_DNA-binding | 49.7 | 8.8e-16 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E+el+++ +++lG++ W+ Ia +++ gRt++++k++w++++ PSME_00052727-RA 67 RGNISYDEEELIIRMHRLLGNR-WSMIAGRLP-GRTDNEIKNYWNSHM 112 788899****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.8E-24 | 6 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.535 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.74E-29 | 13 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.0E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.8E-18 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.71E-10 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.9E-23 | 65 | 114 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.6E-13 | 66 | 114 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 17.398 | 66 | 116 | IPR017930 | Myb domain |
Pfam | PF00249 | 2.9E-13 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.28E-9 | 73 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MGRSGCCSKE VLNRGAWTAE EDLILCEYVR LHGDGGWQKV PQKAGLKRCG KSCRLRWRNY 60 LRPDIKRGNI SYDEEELIIR MHRLLGNRWS MIAGRLPGRT DNEIKNYWNS HMRQNGVQLQ 120 AK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 4e-27 | 12 | 113 | 25 | 125 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025641129.1 | 4e-64 | anthocyanin regulatory C1 protein-like | ||||
Swissprot | P10290 | 7e-60 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | B8LMJ6 | 4e-66 | B8LMJ6_PICSI; Uncharacterized protein | ||||
STRING | evm.model.supercontig_25.114 | 4e-62 | (Carica papaya) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G22640.1 | 2e-58 | myb domain protein 3 |