PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00051403-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 140aa MW: 16300.8 Da PI: 10.9873 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.4 | 1.2e-16 | 17 | 64 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg WT+ Ed++l +++k +G g W++ a++ g++R++k+ck+rw++yl PSME_00051403-RA 17 RGVWTASEDKILSEYIKNHGDGGWRSLANRAGLKRCGKSCKLRWLNYL 64 899********************************************7 PP | |||||||
2 | Myb_DNA-binding | 54.6 | 2.5e-17 | 70 | 113 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ ++eEdellv+++++lG+ W++Ia +++ gRt++++k++w++ PSME_00051403-RA 70 RGNISPEEDELLVRLHRLLGNL-WSLIAGRLP-GRTDNEIKNYWNT 113 7999******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.696 | 12 | 64 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.44E-29 | 14 | 111 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.3E-12 | 16 | 66 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.1E-15 | 17 | 64 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.6E-23 | 19 | 71 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.07E-8 | 20 | 64 | No hit | No description |
PROSITE profile | PS51294 | 25.249 | 65 | 119 | IPR017930 | Myb domain |
SMART | SM00717 | 6.6E-16 | 69 | 117 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.2E-15 | 70 | 113 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.5E-25 | 72 | 118 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.25E-11 | 74 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 140 aa Download sequence Send to blast |
MGRSPSCSKH ENQSLNRGVW TASEDKILSE YIKNHGDGGW RSLANRAGLK RCGKSCKLRW 60 LNYLRPDIKR GNISPEEDEL LVRLHRLLGN LWSLIAGRLP GRTDNEIKNY WNTRLSKRVR 120 MGEFEPKFQK IFPLPLRKKT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-25 | 12 | 119 | 22 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18541146, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JF810440 | 1e-108 | JF810440.1 Picea abies TT2-like protein mRNA, complete cds. | |||
GenBank | KU131218 | 1e-108 | KU131218.1 Picea abies transcription factor MYB29 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022756428.1 | 6e-63 | transcription factor MYB7-like | ||||
Swissprot | Q9S9K9 | 2e-54 | MYB3_ARATH; Transcription factor MYB3 | ||||
TrEMBL | A0A2H4Z0B0 | 6e-81 | A0A2H4Z0B0_9SPER; R2R3 MYB transcription factor | ||||
STRING | XP_004287618.1 | 5e-62 | (Fragaria vesca) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G22640.1 | 3e-49 | myb domain protein 3 |