PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PSME_00050838-RA

Organism

Pseudotsuga menziesii

Taxonomic ID

3357

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

NAC

Protein Properties

Length: 174aa MW: 20076.9 Da PI: 9.6283

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00050838-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	164.8	3e-51	28	154	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 ppGfrF Ptdeelvv+yL+kk +++ +++ +i+evd+yk++Pw+Lp k+ +ekewyfF+++d++y++g+r++r++ sgyWk+tg dk++ + PSME_00050838-RA 28 PPGFRFFPTDEELVVHYLCKKSASQIIPV-PIIAEVDLYKYDPWQLPDKALFGEKEWYFFTPHDRNYPNGSRPKRVAGSGYWKSTGADKPINA 119 9**************************.88***********8777899*********************************** PP NAM 95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128 k +++ vg+kk Lvfy g+apkg+kt+W+mheyrl PSME_00050838-RA 120 KgGKKRVGIKKDLVFYAGKAPKGSKTNWIMHEYRL 154 966777*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.83E-55	21	156	IPR003441	NAC domain
PROSITE profile	PS51005	52.779	27	174	IPR003441	NAC domain
Pfam	PF02365	2.0E-26	28	154	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 174 aa Download sequence Send to blast
MGTSLGDFHE EQPWILKNMD CHEHNQWPPG FRFFPTDEEL VVHYLCKKSA SQIIPVPIIA 60 EVDLYKYDPW QLPDKALFGE KEWYFFTPHD RNYPNGSRPK RVAGSGYWKS TGADKPINAK 120 GGKKRVGIKK DLVFYAGKAP KGSKTNWIMH EYRLADVSRP ARKKGSLRED DLSH

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3swm_A	3e-70	16	171	9	159	NAC domain-containing protein 19
3swm_B	3e-70	16	171	9	159	NAC domain-containing protein 19
3swm_C	3e-70	16	171	9	159	NAC domain-containing protein 19
3swm_D	3e-70	16	171	9	159	NAC domain-containing protein 19
3swp_A	3e-70	16	171	9	159	NAC domain-containing protein 19
3swp_B	3e-70	16	171	9	159	NAC domain-containing protein 19
3swp_C	3e-70	16	171	9	159	NAC domain-containing protein 19
3swp_D	3e-70	16	171	9	159	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses (PubMed:20632034). Transcription activator involved in response to abiotic and biotic stresses. Involved in drought and salt stress responses, and defense response to the rice blast fungus (PubMed:17587305). Transcription activator involved tolerance to cold and salt stresses (PubMed:18273684). Transcription activator involved in tolerance to drought stress. Targets directly and activates genes involved in membrane modification, nicotianamine (NA) biosynthesis, glutathione relocation, accumulation of phosphoadenosine phosphosulfate and glycosylation in roots (PubMed:27892643). Controls root growth at early vegetative stage through chromatin modification and histone lysine deacytaltion by HDAC1 (PubMed:19453457). {ECO:0000269\|PubMed:17587305, ECO:0000269\|PubMed:18273684, ECO:0000269\|PubMed:19453457, ECO:0000269\|PubMed:20632034, ECO:0000269\|PubMed:27892643}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by drought stress, salt stress, cold stress and abscisic acid (ABA) (PubMed:20632034, PubMed:27892643). Induced by methyl jasmonate (PubMed:20632034, PubMed:11332734). Induced by infection with the rice blast fungus Magnaporthe oryzae (PubMed:11332734). {ECO:0000269\|PubMed:11332734, ECO:0000269\|PubMed:20632034, ECO:0000269\|PubMed:27892643}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010268987.1	5e-78	PREDICTED: NAC domain-containing protein 2-like
Swissprot	Q39013	2e-75	NAC2_ARATH; NAC domain-containing protein 2
Swissprot	Q7F2L3	4e-75	NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBL	A0A0D6R3P9	3e-89	A0A0D6R3P9_ARACU; Uncharacterized protein
STRING	XP_010268987.1	2e-77	(Nelumbo nucifera)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	8e-78	NAC family protein

Publications ? help Back to Top
Xiong L,Lee MW,Qi M,Yang Y Identification of defense-related rice genes by suppression subtractive hybridization and differential screening. Mol. Plant Microbe Interact., 2001. 14(5): p. 685-92 [PMID:11332734] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Ohnishi T, et al. OsNAC6, a member of the NAC gene family, is induced by various stresses in rice. Genes Genet. Syst., 2005. 80(2): p. 135-9 [PMID:16172526] Hu H, et al. Characterization of transcription factor gene SNAC2 conferring cold and salt tolerance in rice. Plant Mol. Biol., 2008. 67(1-2): p. 169-81 [PMID:18273684] Kim MJ, et al. Quadruple 9-mer-based protein binding microarray with DsRed fusion protein. BMC Mol. Biol., 2009. 10: p. 91 [PMID:19761621] Chung PJ,Kim JK Epigenetic interaction of OsHDAC1 with the OsNAC6 gene promoter regulates rice root growth. Plant Signal Behav, 2009. 4(7): p. 675-7 [PMID:19820307] Peng HF, et al. Fine mapping of a gene for non-pollen type thermosensitive genic male sterility in rice (Oryza sativa L.). Theor. Appl. Genet., 2010. 120(5): p. 1013-20 [PMID:20012261] Takasaki H, et al. The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol. Genet. Genomics, 2010. 284(3): p. 173-83 [PMID:20632034] Kim MJ, et al. Convenient determination of protein-binding DNA sequences using quadruple 9-mer-based microarray and DsRed-monomer fusion protein. Methods Mol. Biol., 2012. 786: p. 65-77 [PMID:21938620] Gupta SK, et al. The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice. J. Exp. Bot., 2012. 63(2): p. 757-72 [PMID:22058403] Florentin A,Damri M,Grafi G Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization. Dev. Dyn., 2013. 242(10): p. 1121-33 [PMID:23798027] Jensen MK, et al. ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana. FEBS Open Bio, 2013. 3: p. 321-7 [PMID:23951554] Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Nakashima K, et al. Comparative functional analysis of six drought-responsive promoters in transgenic rice. Planta, 2014. 239(1): p. 47-60 [PMID:24062085] Todaka D,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K Toward understanding transcriptional regulatory networks in abiotic stress responses and tolerance in rice. Rice (N Y), 2012. 5(1): p. 6 [PMID:24764506] Qian B, et al. Enhanced drought tolerance in transgenic rice over-expressing of maize C4 phosphoenolpyruvate carboxylase gene via NO and Ca(2+). J. Plant Physiol., 2015. 175: p. 9-20 [PMID:25460871] Shiriga K, et al. Genome-wide identification and expression pattern of drought-responsive members of the NAC family in maize. Meta Gene, 2014. 2: p. 407-17 [PMID:25606426] Yang X, et al. Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis. Plant Cell Rep., 2015. 34(6): p. 943-58 [PMID:25666276] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Farooq MA,Detterbeck A,Clemens S,Dietz KJ Silicon-induced reversibility of cadmium toxicity in rice. J. Exp. Bot., 2016. 67(11): p. 3573-85 [PMID:27122572] Liu Y,Sun J,Wu Y Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice. J. Plant Res., 2016. 129(5): p. 955-962 [PMID:27216423] Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining. PLoS ONE, 2016. 11(9): p. e0162327 [PMID:27618630] Lee DK, et al. The rice OsNAC6 transcription factor orchestrates multiple molecular mechanisms involving root structural adaptions and nicotianamine biosynthesis for drought tolerance. Plant Biotechnol. J., 2017. 15(6): p. 754-764 [PMID:27892643] Zhao J,Missihoun TD,Bartels D The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana. Planta, 2018. 248(4): p. 1017-1027 [PMID:30027414]