PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00050760-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family GATA
Protein Properties Length: 258aa    MW: 29549.5 Da    PI: 10.0102
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00050760-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA48.98.8e-16189223135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       C+ C+t  T lWR+ pd +k+LCnaCG++++k g+
  PSME_00050760-RA 189 CTECKTNRTLLWRNVPDRPKSLCNACGIRFKKIGK 223
                       ********************************886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011410.317183219IPR000679Zinc finger, GATA-type
SMARTSM004013.2E-12183235IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.08E-12184230No hitNo description
Gene3DG3DSA:3.30.50.103.1E-13185225IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.28E-9188222No hitNo description
PROSITE patternPS003440189214IPR000679Zinc finger, GATA-type
PfamPF003201.3E-13189223IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MLRGALCARQ MYDHNHYKKF WLKKMEETED EQTQDSLRTL QPEGFGSRIF WHSSESFRPS  60
LEIKVRIKST IRVSSVRSGA GSKNCERNLA ASEKDLPDGS EIDRALSIGM QMHMPYDADP  120
RNKPQKSVNI FPLQEEGHEE RKLQENGKKS SAKESLQSLK RFLNIGENRL VKTGAMDAEF  180
TDAAVARTCT ECKTNRTLLW RNVPDRPKSL CNACGIRFKK IGKREQQKSG SRLPSVSSVR  240
QMTVKRKQQD NDEYDPLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18380.12e-13GATA transcription factor 20