PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PSME_00049552-RA

Organism

Pseudotsuga menziesii

Taxonomic ID

3357

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

NAC

Protein Properties

Length: 186aa MW: 21355.6 Da PI: 9.84

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00049552-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	162.9	1.2e-50	28	154	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 ppGfrF Ptdeelvv+yL+kk++++ +++ +i+evd+yk++Pw+L k+ +ekewyfF++rd+ky++g+r++r++ sgyWk+tg dk++ + PSME_00049552-RA 28 PPGFRFFPTDEELVVHYLCKKAASQIIPV-PIIEEVDLYKYDPWQLLDKALFGEKEWYFFTPRDRKYPNGSRPKRVAGSGYWKSTGADKPINA 119 9**************************.88**********86667799*********************************** PP NAM 95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128 k +++ vg+kk Lvfy g+apkg+kt+W+mhey l PSME_00049552-RA 120 KgGKKRVGIKKALVFYAGKAPKGSKTNWIMHEYPL 154 966777*************************76 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.23E-55	21	156	IPR003441	NAC domain
PROSITE profile	PS51005	51.969	27	179	IPR003441	NAC domain
Pfam	PF02365	2.1E-26	28	153	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 186 aa Download sequence Send to blast
MGSSLGDFHE EQPWILKNMD CHEHNQWPPG FRFFPTDEEL VVHYLCKKAA SQIIPVPIIE 60 EVDLYKYDPW QLLDKALFGE KEWYFFTPRD RKYPNGSRPK RVAGSGYWKS TGADKPINAK 120 GGKKRVGIKK ALVFYAGKAP KGSKTNWIMH EYPLADVSRP ARKKGSLRVS WYISSLLCFE 180 SAVLTT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	5e-68	16	169	6	154	NO APICAL MERISTEM PROTEIN
1ut4_B	5e-68	16	169	6	154	NO APICAL MERISTEM PROTEIN
1ut7_A	5e-68	16	169	6	154	NO APICAL MERISTEM PROTEIN
1ut7_B	5e-68	16	169	6	154	NO APICAL MERISTEM PROTEIN
3swm_A	5e-68	16	169	9	157	NAC domain-containing protein 19
3swm_B	5e-68	16	169	9	157	NAC domain-containing protein 19
3swm_C	5e-68	16	169	9	157	NAC domain-containing protein 19
3swm_D	5e-68	16	169	9	157	NAC domain-containing protein 19
3swp_A	5e-68	16	169	9	157	NAC domain-containing protein 19
3swp_B	5e-68	16	169	9	157	NAC domain-containing protein 19
3swp_C	5e-68	16	169	9	157	NAC domain-containing protein 19
3swp_D	5e-68	16	169	9	157	NAC domain-containing protein 19
4dul_A	5e-68	16	169	6	154	NAC domain-containing protein 19
4dul_B	5e-68	16	169	6	154	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in stress response. {ECO:0000250\|UniProtKB:Q7F2L3}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress (PubMed:18813954, PubMed:20632034). Induced by dehydration, cold stress and methyl jasmonate (PubMed:20632034). {ECO:0000269\|PubMed:18813954, ECO:0000269\|PubMed:20632034}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008792530.1	7e-77	NAC domain-containing protein 2-like isoform X1
Swissprot	Q52QH4	9e-74	NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBL	A0A0D6R3P9	9e-88	A0A0D6R3P9_ARACU; Uncharacterized protein
STRING	XP_008792530.1	3e-76	(Phoenix dactylifera)
STRING	GSMUA_Achr4P02390_001	2e-76	(Musa acuminata)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G77450.1	5e-76	NAC domain containing protein 32

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Taga Y, et al. Role of OsHSP90 and IREN, Ca2+ dependent nuclease, in plant hypersensitive cell death induced by transcription factor OsNAC4. Plant Signal Behav, 2009. 4(8): p. 740-2 [PMID:19820348] Xia N, et al. Characterization of a novel wheat NAC transcription factor gene involved in defense response against stripe rust pathogen infection and abiotic stresses. Mol. Biol. Rep., 2010. 37(8): p. 3703-12 [PMID:20213512] Takasaki H, et al. The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol. Genet. Genomics, 2010. 284(3): p. 173-83 [PMID:20632034] Nakayama A, et al. Genome-wide identification of WRKY45-regulated genes that mediate benzothiadiazole-induced defense responses in rice. BMC Plant Biol., 2013. 13: p. 150 [PMID:24093634] Ootsubo Y,Hibino T,Wakazono T,Mukai Y,Che FS IREN, a novel EF-hand motif-containing nuclease, functions in the degradation of nuclear DNA during the hypersensitive response cell death in rice. Biosci. Biotechnol. Biochem., 2016. 80(4): p. 748-60 [PMID:26766411]