PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00048117-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 122aa MW: 14089.1 Da PI: 4.5433 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 145.5 | 1.2e-45 | 2 | 89 | 15 | 102 |
NF-YC 15 dfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdelk 102 +fk+h+lPl rikki+k+dedvkmisaea vl+skace+fileltlrswlh+eenkrrtl+++dia a++r d+ dfl+divprde+k PSME_00048117-RA 2 EFKHHQLPLVRIKKIMKSDEDVKMISAEALVLFSKACEIFILELTLRSWLHTEENKRRTLQRNDIAGAISRGDVLDFLLDIVPRDEVK 89 79***********************************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 5.37E-27 | 2 | 100 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.0E-19 | 7 | 70 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene3D | G3DSA:1.10.20.10 | 1.1E-34 | 8 | 85 | IPR009072 | Histone-fold |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MEFKHHQLPL VRIKKIMKSD EDVKMISAEA LVLFSKACEI FILELTLRSW LHTEENKRRT 60 LQRNDIAGAI SRGDVLDFLL DIVPRDEVKE EDNGCTDYLP DTPDGFVEEP RIPEKDSPPV 120 EL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 7e-44 | 2 | 85 | 12 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 57 | 63 | RRTLQRN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000250, ECO:0000269|PubMed:17322342}. | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF085083 | 1e-112 | EF085083.1 Picea sitchensis clone WS0296_J03 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024369382.1 | 1e-52 | nuclear transcription factor Y subunit C-2-like | ||||
Swissprot | Q8LCG7 | 1e-48 | NFYC2_ARATH; Nuclear transcription factor Y subunit C-2 | ||||
Swissprot | Q9FMV5 | 4e-48 | NFYC4_ARATH; Nuclear transcription factor Y subunit C-4 | ||||
TrEMBL | A9NUT0 | 1e-53 | A9NUT0_PICSI; Uncharacterized protein | ||||
STRING | PP1S315_9V6.3 | 5e-52 | (Physcomitrella patens) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G56170.2 | 6e-51 | nuclear factor Y, subunit C2 |