PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00046874-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 186aa MW: 20999.9 Da PI: 10.298 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 172.9 | 9.9e-54 | 17 | 145 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 ppGfrFhPtdeelv +yLkkk+++++l++ ++i+e+d+yk++Pw+Lp k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++l+ PSME_00046874-RA 17 PPGFRFHPTDEELVIHYLKKKASSTPLPV-TIIAEIDLYKFDPWELPGKANFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILT 108 9****************************.89***************999999***************************************9 PP NAM 95 k...kgelvglkktLvfykgrapkgektdWvmheyrl 128 + ++++vg+kk Lvfy gr pkg kt+W+mheyrl PSME_00046874-RA 109 StlgGTQKVGVKKALVFYGGRPPKGIKTNWIMHEYRL 145 99999999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.24E-65 | 10 | 176 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 61.511 | 16 | 175 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.8E-28 | 17 | 145 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 186 aa Download sequence Send to blast |
MESPASFSGS HQQPQFPPGF RFHPTDEELV IHYLKKKASS TPLPVTIIAE IDLYKFDPWE 60 LPGKANFGEQ EWYFFSPRDR KYPNGARPNR AATSGYWKAT GTDKPILTST LGGTQKVGVK 120 KALVFYGGRP PKGIKTNWIM HEYRLADSGA RPSSFPNKKG SLRLDDWVLC RIYKKNGHSQ 180 RVQGAE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-75 | 13 | 181 | 14 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-75 | 13 | 181 | 14 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-75 | 13 | 181 | 14 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-75 | 13 | 181 | 14 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-75 | 13 | 181 | 17 | 174 | NAC domain-containing protein 19 |
3swm_B | 3e-75 | 13 | 181 | 17 | 174 | NAC domain-containing protein 19 |
3swm_C | 3e-75 | 13 | 181 | 17 | 174 | NAC domain-containing protein 19 |
3swm_D | 3e-75 | 13 | 181 | 17 | 174 | NAC domain-containing protein 19 |
3swp_A | 3e-75 | 13 | 181 | 17 | 174 | NAC domain-containing protein 19 |
3swp_B | 3e-75 | 13 | 181 | 17 | 174 | NAC domain-containing protein 19 |
3swp_C | 3e-75 | 13 | 181 | 17 | 174 | NAC domain-containing protein 19 |
3swp_D | 3e-75 | 13 | 181 | 17 | 174 | NAC domain-containing protein 19 |
4dul_A | 3e-75 | 13 | 181 | 14 | 171 | NAC domain-containing protein 19 |
4dul_B | 3e-75 | 13 | 181 | 14 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor of the NAC family associated with male fertility. {ECO:0000250}. | |||||
UniProt | Transcription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00058 | PBM | Transfer from AT1G61110 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017257164.1 | 1e-108 | PREDICTED: NAC transcription factor 25-like | ||||
Swissprot | A2YMR0 | 1e-93 | NAC10_ORYSI; NAC transcription factor ONAC010 | ||||
Swissprot | Q8GY42 | 9e-94 | NAC25_ARATH; NAC transcription factor 25 | ||||
TrEMBL | A0A164VCV4 | 1e-106 | A0A164VCV4_DAUCS; Uncharacterized protein | ||||
STRING | ERN03380 | 1e-106 | (Amborella trichopoda) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G61110.1 | 4e-96 | NAC domain containing protein 25 |