PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00046519-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 60aa MW: 6884.87 Da PI: 11.2696 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 27.1 | 1.2e-08 | 9 | 47 | 54 | 94 |
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 ++ +w+fF+++++k+ r+nr tksgy katg+d+++++ PSME_00046519-RA 9 GDGQWFFFVPSHQKKC--VRPNRLTKSGYSKATGSDRKIHR 47 5679*******99875..7********************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 11.116 | 1 | 60 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 3.92E-7 | 8 | 50 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 60 aa Download sequence Send to blast |
MRGLVRDVGD GQWFFFVPSH QKKCVRPNRL TKSGYSKATG SDRKIHRPGL LPQWFSGSEH |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02450.2 | 4e-09 | NAC domain containing protein 35 |