PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00044819-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 191aa MW: 21833.2 Da PI: 10.079 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 163.3 | 9e-51 | 33 | 159 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 ppGfrF Ptdeelvv+yL+kk++++ +++ +i+evd+yk++Pw+Lp+k+ +ekewyfF++ d+ky++g+r++ra++s yWkatg dk++ + PSME_00044819-RA 33 PPGFRFFPTDEELVVHYLCKKAASQIIPV-PIIAEVDLYKYDPWHLPNKALFGEKEWYFFTPCDRKYPNGSRPKRAASSRYWKATGADKPINA 124 9****************************.88***************8888899*************************************** PP NAM 95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128 k +++ vg+kk Lvfy g+apkg+kt+W+mheyrl PSME_00044819-RA 125 KgGKKRVGIKKALVFYAGKAPKGSKTNWIMHEYRL 159 966777***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.75E-54 | 26 | 161 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 51.627 | 32 | 184 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.9E-25 | 33 | 159 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 191 aa Download sequence Send to blast |
SPTTNMGTSL GEFHEEQPWI LKNMDCHEHN QWPPGFRFFP TDEELVVHYL CKKAASQIIP 60 VPIIAEVDLY KYDPWHLPNK ALFGEKEWYF FTPCDRKYPN GSRPKRAASS RYWKATGADK 120 PINAKGGKKR VGIKKALVFY AGKAPKGSKT NWIMHEYRLA DVSRPARKKG SLRVSWSISS 180 LLCFESAVLT T |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-69 | 33 | 175 | 18 | 155 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-69 | 33 | 175 | 18 | 155 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-69 | 33 | 175 | 18 | 155 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-69 | 33 | 175 | 18 | 155 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-69 | 21 | 175 | 9 | 158 | NAC domain-containing protein 19 |
3swm_B | 4e-69 | 21 | 175 | 9 | 158 | NAC domain-containing protein 19 |
3swm_C | 4e-69 | 21 | 175 | 9 | 158 | NAC domain-containing protein 19 |
3swm_D | 4e-69 | 21 | 175 | 9 | 158 | NAC domain-containing protein 19 |
3swp_A | 4e-69 | 21 | 175 | 9 | 158 | NAC domain-containing protein 19 |
3swp_B | 4e-69 | 21 | 175 | 9 | 158 | NAC domain-containing protein 19 |
3swp_C | 4e-69 | 21 | 175 | 9 | 158 | NAC domain-containing protein 19 |
3swp_D | 4e-69 | 21 | 175 | 9 | 158 | NAC domain-containing protein 19 |
4dul_A | 4e-69 | 33 | 175 | 18 | 155 | NAC domain-containing protein 19 |
4dul_B | 4e-69 | 33 | 175 | 18 | 155 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in stress response. {ECO:0000250|UniProtKB:Q7F2L3}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress (PubMed:18813954, PubMed:20632034). Induced by dehydration, cold stress and methyl jasmonate (PubMed:20632034). {ECO:0000269|PubMed:18813954, ECO:0000269|PubMed:20632034}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008792530.1 | 3e-77 | NAC domain-containing protein 2-like isoform X1 | ||||
Refseq | XP_020578930.1 | 2e-77 | NAC domain-containing protein 68-like | ||||
Refseq | XP_022159665.1 | 2e-77 | NAC domain-containing protein 2-like | ||||
Swissprot | Q52QH4 | 1e-74 | NAC68_ORYSJ; NAC domain-containing protein 68 | ||||
TrEMBL | A0A0D6R3P9 | 3e-88 | A0A0D6R3P9_ARACU; Uncharacterized protein | ||||
STRING | XP_008792530.1 | 1e-76 | (Phoenix dactylifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G01720.1 | 5e-77 | NAC family protein |