PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00037046-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 154aa MW: 18032 Da PI: 8.6288 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 141 | 6.8e-44 | 24 | 150 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 pGfrF Pt+eel+++yLkk+++g + +++ i+++d+y+++Pw+Lp +++ ek+w+fF++r++k+ r++r t sgyWkatg+d+++ PSME_00037046-RA 24 IPGFRFYPTEEELLSFYLKKRIQGGQQVNFDIiIPTLDMYRYDPWELPgLAIDVAEKQWFFFVPRETKKC--ARPTRLTVSGYWKATGSDRAI 114 69*********************9995555555***************77888999*********99875..7******************** PP NAM 93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ e +glkktLvfykg+ap g++tdW+m+eyr+ PSME_00037046-RA 115 RNELLECIGLKKTLVFYKGKAPLGQRTDWIMNEYRM 150 **99999***************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.27E-42 | 16 | 151 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 46.315 | 23 | 154 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.9E-24 | 25 | 150 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MRMAMAFLEE IYNDGAFKGE LPVIPGFRFY PTEEELLSFY LKKRIQGGQQ VNFDIIIPTL 60 DMYRYDPWEL PGLAIDVAEK QWFFFVPRET KKCARPTRLT VSGYWKATGS DRAIRNELLE 120 CIGLKKTLVF YKGKAPLGQR TDWIMNEYRM PDLA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-37 | 20 | 150 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-37 | 20 | 150 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-37 | 20 | 150 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-37 | 20 | 150 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
4dul_A | 3e-37 | 20 | 150 | 14 | 142 | NAC domain-containing protein 19 |
4dul_B | 3e-37 | 20 | 150 | 14 | 142 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT109581 | 1e-146 | BT109581.1 Picea glauca clone GQ03210_D16 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004301581.1 | 2e-53 | PREDICTED: NAC domain-containing protein 48 | ||||
Refseq | XP_008339444.2 | 3e-53 | NAC domain-containing protein 35 | ||||
Refseq | XP_020598401.1 | 1e-53 | NAC domain-containing protein 35-like, partial | ||||
Swissprot | Q9ZVP8 | 4e-51 | NAC35_ARATH; NAC domain-containing protein 35 | ||||
TrEMBL | A0A075M5N5 | 2e-74 | A0A075M5N5_9SPER; NAC domain protein | ||||
STRING | XP_008339444.1 | 1e-52 | (Malus domestica) | ||||
STRING | XP_008352818.1 | 1e-52 | (Malus domestica) | ||||
STRING | XP_004301581.1 | 8e-53 | (Fragaria vesca) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02450.2 | 1e-53 | NAC domain containing protein 35 |
Publications ? help Back to Top | |||
---|---|---|---|
|