PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00037043-RA
Organism
Pseudotsuga menziesii
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family NAC
Protein Properties Length: 74aa    MW: 8759.13 Da    PI: 10.6628
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00037043-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM57.93.4e-18227080128
               NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         yWkatg+d+++ ++  e +glkk+Lvfykg+ap g++tdW+m+eyr+
  PSME_00037043-RA  22 PDYWKATGSDRKIRNELLECIGLKKSLVFYKGKAPLGQRTDWIMNEYRV 70 
                       569************99999***************************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100521.055174IPR003441NAC domain
PfamPF023652.6E-81970IPR003441NAC domain
SuperFamilySSF1019412.35E-152273IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 74 aa     Download sequence    Send to blast
MLRRNNCSSS FQERVRNACG LPDYWKATGS DRKIRNELLE CIGLKKSLVF YKGKAPLGQR  60
TDWIMNEYRV RHPR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020598401.12e-17NAC domain-containing protein 35-like, partial
RefseqXP_021824741.12e-17NAC domain-containing protein 35 isoform X1
RefseqXP_021824742.13e-17NAC domain-containing protein 35 isoform X2
RefseqXP_022942999.12e-17ferric reduction oxidase 7, chloroplastic-like
RefseqXP_023542912.12e-17ferric reduction oxidase 7, chloroplastic-like
SwissprotQ9ZVP83e-17NAC35_ARATH; NAC domain-containing protein 35
TrEMBLA0A075M5N59e-20A0A075M5N5_9SPER; NAC domain protein
STRINGEMJ267777e-17(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-19NAC domain containing protein 35
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Okajima K
    Molecular mechanism of phototropin light signaling.
    J. Plant Res., 2016. 129(2): p. 149-57
    [PMID:26815763]
  3. Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M
    Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii.
    J Phys Chem B, 2018. 122(6): p. 1801-1815
    [PMID:29355019]