PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00036811-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 195aa MW: 21719 Da PI: 8.8314 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 145.7 | 1.3e-45 | 8 | 107 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 +CaaCk+lrrkC+ +Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA+ar++dPvyG+vg i+ lq+q++ql++e PSME_00036811-RA 8 PCAACKFLRRKCTLECVFAPYFPPDQPQKFANVHKIFGASNVTKLLNELHPHQREDAVNSLAYEADARVKDPVYGCVGAISILQHQVKQLQTE 100 7******************************************************************************************** PP DUF260 94 lallkee 100 l+++++e PSME_00036811-RA 101 LHHARSE 107 **99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 27.456 | 7 | 108 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.4E-44 | 8 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
MASSSNSPCA ACKFLRRKCT LECVFAPYFP PDQPQKFANV HKIFGASNVT KLLNELHPHQ 60 REDAVNSLAY EADARVKDPV YGCVGAISIL QHQVKQLQTE LHHARSELSK FINAGIAIPP 120 MGGGSGIGMG LAGSSRDQIF RDQNIMESHI SRDHLLRARE EGGIEFLRFT VHSCLRTPKF 180 KPALFFLIYI EMHGK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-57 | 5 | 111 | 8 | 114 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-57 | 5 | 111 | 8 | 114 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
UniProt | Promotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00581 | DAP | Transfer from AT5G63090 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | - | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT119542 | 0.0 | BT119542.1 Picea glauca clone GQ04106_O21 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024356367.1 | 2e-70 | protein LATERAL ORGAN BOUNDARIES-like isoform X1 | ||||
Refseq | XP_024356368.1 | 2e-70 | protein LATERAL ORGAN BOUNDARIES-like isoform X2 | ||||
Refseq | XP_024356369.1 | 2e-70 | protein LATERAL ORGAN BOUNDARIES-like isoform X2 | ||||
Refseq | XP_024356370.1 | 2e-70 | protein LATERAL ORGAN BOUNDARIES-like isoform X2 | ||||
Refseq | XP_024356371.1 | 2e-70 | protein LATERAL ORGAN BOUNDARIES-like isoform X2 | ||||
Swissprot | Q32SG3 | 2e-57 | LBD6_MAIZE; LOB domain-containing protein 6 | ||||
Swissprot | Q9FML4 | 6e-58 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A2K1IZ19 | 4e-69 | A0A2K1IZ19_PHYPA; Uncharacterized protein | ||||
STRING | PP1S170_93V6.1 | 7e-70 | (Physcomitrella patens) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 1e-59 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|