PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PSME_00036304-RA

Organism

Pseudotsuga menziesii

Taxonomic ID

3357

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

NAC

Protein Properties

Length: 186aa MW: 21132.1 Da PI: 9.6279

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00036304-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	159.7	1.2e-49	33	162	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 lppGfrFhPtdeelvv+yLkkk+++++l++ ++i+e+d+yk+ Pw+Lp k++ +e+ewyfFs+rd+ky++g r+n a++ gyWkatg dk++l PSME_00036304-RA 33 LPPGFRFHPTDEELVVHYLKKKASSTPLPV-TIIAEIDLYKFYPWELPGKATFGEQEWYFFSPRDRKYPNGARPNSAATYGYWKATGMDKPIL 124 79**************************.89***********8888999*****************9999********* PP NAM 94 sk...kgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ ++++vg+kk vfy gr pkg kt+W+mheyrl PSME_00036304-RA 125 TStsgGTQKVGVKKAPVFYGGRPPKGIKTNWIMHEYRL 162 998888899*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.83E-56	28	172	IPR003441	NAC domain
PROSITE profile	PS51005	55.192	33	186	IPR003441	NAC domain
Pfam	PF02365	8.5E-26	34	162	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 186 aa Download sequence Send to blast
ILSEFRQFDF FCSNCELMES PASFLGSHQQ PQLPPGFRFH PTDEELVVHY LKKKASSTPL 60 PVTIIAEIDL YKFYPWELPG KATFGEQEWY FFSPRDRKYP NGARPNSAAT YGYWKATGMD 120 KPILTSTSGG TQKVGVKKAP VFYGGRPPKG IKTNWIMHEY RLADSGARPS SFPNKKGSLR 180 IDDWVL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-64	30	186	14	159	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-64	30	186	14	159	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-64	30	186	14	159	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-64	30	186	14	159	NO APICAL MERISTEM PROTEIN
3swm_A	2e-64	30	186	17	162	NAC domain-containing protein 19
3swm_B	2e-64	30	186	17	162	NAC domain-containing protein 19
3swm_C	2e-64	30	186	17	162	NAC domain-containing protein 19
3swm_D	2e-64	30	186	17	162	NAC domain-containing protein 19
3swp_A	2e-64	30	186	17	162	NAC domain-containing protein 19
3swp_B	2e-64	30	186	17	162	NAC domain-containing protein 19
3swp_C	2e-64	30	186	17	162	NAC domain-containing protein 19
3swp_D	2e-64	30	186	17	162	NAC domain-containing protein 19
4dul_A	2e-64	30	186	14	159	NAC domain-containing protein 19
4dul_B	2e-64	30	186	14	159	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor of the NAC family associated with the grain protein content (GPC). Accelerates senescence and increases nutrient remobilization from leaves to developing grains. Sequences of 11 European varieties of H.vulgare tested belongs to the same haplotype while the sequence found in H.spontaneum, an ancestor of the cultivated H.vulgare which has a higher GPC, belongs to an other haplotype. {ECO:0000269\|PubMed:17124321}.
UniProt	Transcription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:18849494, ECO:0000305\|PubMed:21107887}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017257164.1	9e-97	PREDICTED: NAC transcription factor 25-like
Swissprot	A0SPJ9	1e-81	NAM2_HORVV; NAC transcription factor NAM-2
Swissprot	Q8GY42	2e-82	NAC25_ARATH; NAC transcription factor 25
TrEMBL	A0A164VCV4	2e-95	A0A164VCV4_DAUCS; Uncharacterized protein
STRING	XP_007149615.1	9e-94	(Phaseolus vulgaris)
STRING	XP_009769986.1	9e-94	(Nicotiana sylvestris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G61110.1	9e-85	NAC domain containing protein 25

Publications ? help Back to Top
Uauy C,Distelfeld A,Fahima T,Blechl A,Dubcovsky J A NAC Gene regulating senescence improves grain protein, zinc, and iron content in wheat. Science, 2006. 314(5803): p. 1298-301 [PMID:17124321]