PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00034173-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 115aa MW: 12965.3 Da PI: 5.6877 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 59.5 | 9.2e-19 | 53 | 98 | 1 | 46 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkll 46 +CaaCk+lrr+C+++C+++pyf +p+kfanvhk+FGasn++ +l PSME_00034173-RA 53 PCAACKLLRRRCVQECPFSPYFSPLEPEKFANVHKVFGASNICAML 98 7******************************************998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 14.415 | 52 | 115 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.4E-18 | 53 | 98 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 115 aa Download sequence Send to blast |
MVAKRCEQPD TLDVTAQIDW IILSRKIFEE TDVCEMAHRP MLGSPDVLNT ITPCAACKLL 60 RRRCVQECPF SPYFSPLEPE KFANVHKVFG ASNICAMLLV TLFQTFLLIG ICISD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-18 | 44 | 98 | 2 | 56 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-18 | 44 | 98 | 2 | 56 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006376019.2 | 4e-34 | LOB domain-containing protein 15 | ||||
Refseq | XP_016684598.1 | 3e-34 | PREDICTED: LOB domain-containing protein 15-like | ||||
Swissprot | Q8L5T5 | 1e-31 | LBD15_ARATH; LOB domain-containing protein 15 | ||||
TrEMBL | A0A1U8J7K8 | 6e-33 | A0A1U8J7K8_GOSHI; LOB domain-containing protein 15-like | ||||
TrEMBL | A0A2K1Y2W3 | 9e-33 | A0A2K1Y2W3_POPTR; Uncharacterized protein | ||||
STRING | cassava4.1_029925m | 4e-33 | (Manihot esculenta) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G40470.1 | 6e-34 | LOB domain-containing protein 15 |
Publications ? help Back to Top | |||
---|---|---|---|
|