PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PSME_00029149-RA

Organism

Pseudotsuga menziesii

Taxonomic ID

3357

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

MYB_related

Protein Properties

Length: 153aa MW: 17137.7 Da PI: 10.5241

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00029149-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	47.8	3.4e-15	55	100	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 r ++T++E+ ++ +++ lG++ W+tIa+ ++ gRt++++k++w ++l PSME_00029149-RA 55 RSSFTQQEERSIIMLHAILGNK-WSTIASLLP-GRTDNEIKNFWSTHL 100 679*****************.*****.*********9886 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	1.3E-19	40	109	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	8.2E-6	42	62	IPR009057	Homeodomain-like
PROSITE profile	PS51294	22.668	50	104	IPR017930	Myb domain
SMART	SM00717	1.8E-13	54	102	IPR001005	SANT/Myb domain
Pfam	PF00249	3.2E-13	55	100	IPR001005	SANT/Myb domain
CDD	cd00167	7.37E-10	57	100	No hit	No description
Gene3D	G3DSA:1.10.10.60	4.9E-20	63	101	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 153 aa Download sequence Send to blast
FSVATLGKGP CCKETGLKEG SLDSTARGIG VLFPSLLWEK LSLRWTNYLN PDIKRSSFTQ 60 QEERSIIMLH AILGNKWSTI ASLLPGRTDN EIKNFWSTHL KKRLLKMGLD TSTHAPIAES 120 NPSVPQWSEA LALMRHTARS RSSALERITA YVR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	6e-20	44	104	48	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the control of epidermal cell morphogenesis in petals. Promotes unidirectional cell expansion once outgrowth has been initiated (PubMed:17376813). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). Functions as a major regulator of cuticle formation in vegetative organs by regulating the cuticle biosynthesis genes CYP86A8/LCR and CER1 (PubMed:24169067). {ECO:0000269\|PubMed:17376813, ECO:0000269\|PubMed:23709630, ECO:0000269\|PubMed:24169067}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002444838.1	1e-38	transcription factor MYB41
Refseq	XP_015695646.1	1e-39	PREDICTED: transcription factor MYB39-like
Swissprot	Q9LXF1	6e-38	MYB16_ARATH; Transcription factor MYB16
TrEMBL	A0A222UAM7	4e-41	A0A222UAM7_GINBI; R2R3MYB15
STRING	LPERR06G07150.1	2e-38	(Leersia perrieri)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G15310.2	2e-40	myb domain protein 16

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang BH, et al. Positive selection and functional divergence of R2R3-MYB paralogous genes expressed in inflorescence buds of Scutellaria species (Labiatae). Int J Mol Sci, 2015. 16(3): p. 5900-21 [PMID:25782156] Cui F, et al. Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation. Mol Plant, 2016. 9(6): p. 926-38 [PMID:27060495]