 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PSME_00026510-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 66aa MW: 7337.51 Da PI: 7.1803 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 47.6 | 4.7e-15 | 4 | 56 | 47 | 99 |
DUF260 47 kalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
+++p ++r+da+++++ eA ar++dPvyG++g+i +lq +++ql+++la+++
PSME_00026510-RA 4 QNVPVDKRSDAVRCMIIEASARVKDPVYGCTGIICQLQLRVSQLQSQLAKTQG 56
789999*******************************************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 9.91 | 1 | 58 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 1.6E-14 | 4 | 55 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 66 aa Download sequence Send to blast |
MDYQNVPVDK RSDAVRCMII EASARVKDPV YGCTGIICQL QLRVSQLQSQ LAKTQGDLHS 60 IVSMLD |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010104136.1 | 2e-17 | LOB domain-containing protein 1 | ||||
| Swissprot | Q9LQR0 | 8e-15 | LBD1_ARATH; LOB domain-containing protein 1 | ||||
| Swissprot | Q9SK08 | 9e-15 | LBD11_ARATH; LOB domain-containing protein 11 | ||||
| TrEMBL | A0A392N9C5 | 3e-17 | A0A392N9C5_9FABA; LOB domain protein (Fragment) | ||||
| STRING | XP_010104136.1 | 6e-17 | (Morus notabilis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G30130.1 | 1e-10 | LBD family protein | ||||
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|