PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00025688-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | ARR-B | ||||||||
Protein Properties | Length: 227aa MW: 25659 Da PI: 5.222 | ||||||||
Description | ARR-B family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 83.5 | 2.2e-26 | 163 | 213 | 1 | 52 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 kpr++W+ eLH++Fv+av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQ+ PSME_00025688-RA 163 KPRVVWSVELHQQFVNAVNQL-GIDKAVPKRILELMHVQGLTRENVASHLQM 213 79*******************.*****************************8 PP | |||||||
2 | Response_reg | 59.2 | 2.3e-20 | 2 | 86 | 26 | 109 |
EEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS Response_reg 26 vaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109 v+++ +++al +l+ek+ +Dl++ D+ mp+mdG++ll++ e +lp+i+++a g +++ + +k Ga d+l Kp+ eel + PSME_00025688-RA 2 VTTCCRATAALSMLREKKgaFDLVISDVYMPDMDGFKLLEHVGLEM-DLPVIMMSADGGTSTVMKGIKHGACDYLIKPVRLEELKN 86 789999********999999**********************6644.8***********************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50110 | 34.333 | 1 | 92 | IPR001789 | Signal transduction response regulator, receiver domain |
PIRSF | PIRSF036392 | 2.1E-119 | 1 | 213 | IPR017053 | Response regulator B-type, plant |
SMART | SM00448 | 4.7E-7 | 1 | 88 | IPR001789 | Signal transduction response regulator, receiver domain |
CDD | cd00156 | 2.50E-21 | 2 | 92 | No hit | No description |
SuperFamily | SSF52172 | 1.85E-26 | 2 | 100 | IPR011006 | CheY-like superfamily |
Pfam | PF00072 | 5.2E-17 | 2 | 86 | IPR001789 | Signal transduction response regulator, receiver domain |
Gene3D | G3DSA:3.40.50.2300 | 2.7E-32 | 2 | 116 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.4E-26 | 160 | 214 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.79E-16 | 161 | 214 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 2.2E-23 | 163 | 213 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 1.1E-6 | 165 | 213 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000160 | Biological Process | phosphorelay signal transduction system | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 227 aa Download sequence Send to blast |
MVTTCCRATA ALSMLREKKG AFDLVISDVY MPDMDGFKLL EHVGLEMDLP VIMMSADGGT 60 STVMKGIKHG ACDYLIKPVR LEELKNIWQH VIRKKRNEPK DFDHSGSFED NDRHRKGSED 120 VDYASSVNEG TDGSWKLLKK RKEAKEEEDD GEEDNDDPSA SKKPRVVWSV ELHQQFVNAV 180 NQLGIDKAVP KRILELMHVQ GLTRENVASH LQMVDMTDTD SNKSEQI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1irz_A | 3e-18 | 159 | 212 | 1 | 54 | ARR10-B |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 135 | 141 | KLLKKRK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF082341 | 0.0 | EF082341.1 Picea sitchensis clone WS0277_N09 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006849799.1 | 1e-125 | two-component response regulator ORR21 isoform X1 | ||||
Refseq | XP_011625385.1 | 1e-125 | two-component response regulator ORR21 isoform X2 | ||||
Swissprot | A2XE31 | 4e-97 | ORR21_ORYSI; Two-component response regulator ORR21 | ||||
Swissprot | Q8H7S7 | 4e-97 | ORR21_ORYSJ; Two-component response regulator ORR21 | ||||
TrEMBL | A0A0D6R4K9 | 1e-127 | A0A0D6R4K9_ARACU; Uncharacterized protein | ||||
STRING | ERN11380 | 1e-125 | (Amborella trichopoda) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G16110.1 | 2e-83 | response regulator 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|