PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00024681-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 74aa MW: 8912.22 Da PI: 10.6162 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 22.9 | 1.9e-07 | 2 | 35 | 11 | 44 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 11 qkNReAArrsRqRKkaeieeLeekvkeLeaeNka 44 +NRe+A+ s +RK++ ++eL+ + L a+N++ PSME_00024681-RA 2 FSNRESAKSSQLRKQQHLDELRAQMVHLMAKNEE 35 69******************************84 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57959 | 1.24E-5 | 1 | 34 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 1.2E-4 | 3 | 36 | No hit | No description |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 74 aa Download sequence Send to blast |
MFSNRESAKS SQLRKQQHLD ELRAQMVHLM AKNEESVKRT QIQKQQHLDE LRAHMVHLMV 60 ENKEYAKRSQ LQKQ |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G75390.1 | 3e-09 | basic leucine-zipper 44 |