PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00021188-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | Trihelix | ||||||||
Protein Properties | Length: 272aa MW: 30708.1 Da PI: 7.9572 | ||||||||
Description | Trihelix family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | trihelix | 30.2 | 1.2e-09 | 1 | 30 | 38 | 67 |
trihelix 38 mrergferspkqCkekwenlnkrykkikeg 67 m+e+gf+rs+kqCk+kw+nl +ry++ + PSME_00021188-RA 1 MKEKGFRRSSKQCKCKWKNLVNRYRQQQIP 30 89**********************987644 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF13837 | 7.3E-7 | 1 | 33 | No hit | No description |
Gene3D | G3DSA:1.10.150.20 | 3.6E-19 | 30 | 90 | No hit | No description |
SuperFamily | SSF47794 | 1.29E-9 | 38 | 91 | IPR010995 | DNA repair Rad51/transcription factor NusA, alpha-helical |
SuperFamily | SSF52540 | 2.53E-28 | 90 | 270 | IPR027417 | P-loop containing nucleoside triphosphate hydrolase |
CDD | cd01123 | 5.16E-63 | 90 | 270 | No hit | No description |
Pfam | PF08423 | 2.4E-64 | 90 | 270 | IPR013632 | DNA recombination and repair protein Rad51, C-terminal |
Gene3D | G3DSA:3.40.50.300 | 3.4E-46 | 91 | 270 | IPR027417 | P-loop containing nucleoside triphosphate hydrolase |
PROSITE profile | PS50162 | 17.333 | 96 | 239 | IPR020588 | DNA recombination and repair protein RecA-like, ATP-binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006281 | Biological Process | DNA repair | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0005524 | Molecular Function | ATP binding | ||||
GO:0008094 | Molecular Function | DNA-dependent ATPase activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 272 aa Download sequence Send to blast |
MKEKGFRRSS KQCKCKWKNL VNRYRQQQIP QEEENEEELQ HGPYPVEQLQ ACGISVVDIK 60 KLEDAEHCTV EAVAYYPKKE LVQIKGLSDA KLPLDQGGGE GKALYIDAEG TFRPQRLLQI 120 AERYEELFTF GFERLNSQTF NILRSYRFGL NGADVLENVA YARAYNTDHQ SRLLMEAASM 180 MAETRFALMI VDSATSLYRI EFVGRGELSA RQMHLAKFLR SLQKMADEFG VVVVVTNQVV 240 AQVDGSAMFA GPQLKPIGGN IIAHASTTRF GK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n0w_A | 9e-79 | 91 | 270 | 49 | 204 | DNA repair protein RAD51 homolog 1 |
5np7_C | 8e-78 | 37 | 270 | 16 | 300 | DNA repair protein RAD51 homolog 1 |
5np7_D | 8e-78 | 37 | 270 | 16 | 300 | DNA repair protein RAD51 homolog 1 |
5np7_E | 8e-78 | 37 | 270 | 16 | 300 | DNA repair protein RAD51 homolog 1 |
5np7_F | 8e-78 | 37 | 270 | 16 | 300 | DNA repair protein RAD51 homolog 1 |
5np7_G | 8e-78 | 37 | 270 | 16 | 300 | DNA repair protein RAD51 homolog 1 |
5nwl_A | 8e-78 | 37 | 270 | 16 | 300 | DNA repair protein RAD51 homolog 1 |
5nwl_B | 8e-78 | 37 | 270 | 16 | 300 | DNA repair protein RAD51 homolog 1 |
5nwl_C | 8e-78 | 37 | 270 | 16 | 300 | DNA repair protein RAD51 homolog 1 |
5nwl_D | 8e-78 | 37 | 270 | 16 | 300 | DNA repair protein RAD51 homolog 1 |
5nwl_E | 8e-78 | 37 | 270 | 16 | 300 | DNA repair protein RAD51 homolog 1 |
5nwl_F | 8e-78 | 37 | 270 | 16 | 300 | DNA repair protein RAD51 homolog 1 |
5nwl_G | 8e-78 | 37 | 270 | 16 | 300 | DNA repair protein RAD51 homolog 1 |
5nwl_H | 8e-78 | 37 | 270 | 16 | 300 | DNA repair protein RAD51 homolog 1 |
5nwl_I | 8e-78 | 37 | 270 | 16 | 300 | DNA repair protein RAD51 homolog 1 |
5nwl_J | 8e-78 | 37 | 270 | 16 | 300 | DNA repair protein RAD51 homolog 1 |
5nwl_K | 8e-78 | 37 | 270 | 16 | 300 | DNA repair protein RAD51 homolog 1 |
5nwl_L | 8e-78 | 37 | 270 | 16 | 300 | DNA repair protein RAD51 homolog 1 |
5nwl_M | 8e-78 | 37 | 270 | 16 | 300 | DNA repair protein RAD51 homolog 1 |
5nwl_N | 8e-78 | 37 | 270 | 16 | 300 | DNA repair protein RAD51 homolog 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to single and double-stranded DNA and exhibits DNA-dependent ATPase activity. Unwinds duplex DNA (By similarity). Component of the meiotic recombination pathway. Seems to play a role in mediating chromosome homology search, chromosome pairing and synapsis at early stages and probably chromosome crossing-over at later stages in meiosis. Probably is involved in the repair of meiotic double strand breaks (DBSs) and in homologous recombination. {ECO:0000250, ECO:0000269|PubMed:10330467, ECO:0000269|PubMed:12897254}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT118588 | 1e-170 | BT118588.1 Picea glauca clone GQ04008_A03 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012447907.1 | 1e-112 | PREDICTED: DNA repair protein RAD51 homolog isoform X4 | ||||
Swissprot | Q9XED7 | 9e-95 | R51A2_MAIZE; DNA repair protein RAD51 homolog B | ||||
TrEMBL | A0A1U8JN72 | 1e-109 | A0A1U8JN72_GOSHI; DNA repair protein RAD51 homolog isoform X3 | ||||
STRING | Lus10039928 | 1e-110 | (Linum usitatissimum) |
Publications ? help Back to Top | |||
---|---|---|---|
|