PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PSME_00017053-RA

Organism

Pseudotsuga menziesii

Taxonomic ID

3357

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

NAC

Protein Properties

Length: 290aa MW: 33313.5 Da PI: 9.8105

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00017053-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	166.3	1e-51	28	154	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 ppGfrF Ptdeelvv+yL+kk++++ +++ +i+evd+yk++Pw+Lp k+ +ekewyfF++rd+ky++g+r++ra+ sgyWkatg dk++ + PSME_00017053-RA 28 PPGFRFFPTDEELVVHYLCKKAASQIIPV-PIIAEVDLYKYDPWQLPDKALFGEKEWYFFTPRDRKYPNGSRPKRAAGSGYWKATGADKPINA 119 8**************************.88***********8777899*********************************** PP NAM 95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128 k +++ vg+k+ Lvfy g+apkg+kt+W+mheyrl PSME_00017053-RA 120 KgGKKRVGIKQALVFYAGKAPKGSKTNWIMHEYRL 154 966777*************************98 PP
2	NAM	87.3	2.9e-27	211	290	2	82
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgy 82 ppGfrF Ptdeelvv+yL+kk++++ +++ +i+evd+yk++Pw+Lp k+ +ekewyfF++ d+ky++g+r++ra+ sgy PSME_00017053-RA 211 PPGFRFFPTDEELVVHYLCKKAASQIIPV-PIIAEVDLYKYDPWQLPDKALFGEKEWYFFTPCDRKYPNGSRRKRAAGSGY 290 8**************************.88***********8777899********************99998 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	6.41E-57	21	156	IPR003441	NAC domain
PROSITE profile	PS51005	54.057	27	179	IPR003441	NAC domain
Pfam	PF02365	1.4E-26	28	154	IPR003441	NAC domain
SuperFamily	SSF101941	7.98E-32	204	290	IPR003441	NAC domain
PROSITE profile	PS51005	31.714	210	290	IPR003441	NAC domain
Pfam	PF02365	4.2E-11	211	290	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 290 aa Download sequence Send to blast
MGTSLGDFHE EQPWILKNMD CHEHNQWPPG FRFFPTDEEL VVHYLCKKAA SQIIPVPIIA 60 EVDLYKYDPW QLPDKALFGE KEWYFFTPRD RKYPNGSRPK RAAGSGYWKA TGADKPINAK 120 GGKKRVGIKQ ALVFYAGKAP KGSKTNWIMH EYRLADVSRP ARKKGSLRIP SSLCVMGRIK 180 GLGTIRVAIH LEELCKQARD HCALLVHNQW PPGFRFFPTD EELVVHYLCK KAASQIIPVP 240 IIAEVDLYKY DPWQLPDKAL FGEKEWYFFT PCDRKYPNGS RRKRAAGSGY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	4e-69	16	290	6	154	NO APICAL MERISTEM PROTEIN
1ut4_B	4e-69	16	290	6	154	NO APICAL MERISTEM PROTEIN
1ut7_A	4e-69	16	290	6	154	NO APICAL MERISTEM PROTEIN
1ut7_B	4e-69	16	290	6	154	NO APICAL MERISTEM PROTEIN
3swm_A	3e-69	16	290	9	157	NAC domain-containing protein 19
3swm_B	3e-69	16	290	9	157	NAC domain-containing protein 19
3swm_C	3e-69	16	290	9	157	NAC domain-containing protein 19
3swm_D	3e-69	16	290	9	157	NAC domain-containing protein 19
3swp_A	3e-69	16	290	9	157	NAC domain-containing protein 19
3swp_B	3e-69	16	290	9	157	NAC domain-containing protein 19
3swp_C	3e-69	16	290	9	157	NAC domain-containing protein 19
3swp_D	3e-69	16	290	9	157	NAC domain-containing protein 19
4dul_A	4e-69	16	290	6	154	NAC domain-containing protein 19
4dul_B	4e-69	16	290	6	154	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that positively regulates age-dependent senescence, dark-induced leaf senescence and stress-induced senescence. Regulates leaf senescence through the modulation of the expression of senescence-associated genes SGR1/NYE1, SAG113 and SAUR36/SAG201, which are involved in chlorophyll degradation, and abscisic acid (ABA) and auxin promotion of senescence, respectively. Promotes reactive oxygen species (ROS) production during age-dependent and stress-induced senescence. Regulates positively auxin-mediated responses in roots (PubMed:27388337). Stress-responsive NAC transcription factor involved in ABA-inducible leaf senescence signaling (PubMed:26518251). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:18849494, ECO:0000269\|PubMed:26518251, ECO:0000269\|PubMed:27388337}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA) (PubMed:26518251). Induced by salinity and osmotic stress, and during leaf senescence (PubMed:27388337). {ECO:0000269\|PubMed:26518251, ECO:0000269\|PubMed:27388337}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_026426066.1	3e-79	NAC domain-containing protein 68-like
Swissprot	Q39013	6e-76	NAC2_ARATH; NAC domain-containing protein 2
Swissprot	Q9CAR0	3e-76	NAC32_ARATH; NAC transcription factor 32
TrEMBL	A0A0D6R3P9	5e-90	A0A0D6R3P9_ARACU; Uncharacterized protein
STRING	Gorai.010G051900.1	3e-78	(Gossypium raimondii)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G77450.1	1e-78	NAC domain containing protein 32

Publications ? help Back to Top
Florentin A,Damri M,Grafi G Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization. Dev. Dyn., 2013. 242(10): p. 1121-33 [PMID:23798027] Jensen MK, et al. ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana. FEBS Open Bio, 2013. 3: p. 321-7 [PMID:23951554] Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress. Plant Cell, 2014. 26(12): p. 4656-79 [PMID:25549671] Yang X, et al. Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis. Plant Cell Rep., 2015. 34(6): p. 943-58 [PMID:25666276] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Liu Y,Sun J,Wu Y Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice. J. Plant Res., 2016. 129(5): p. 955-962 [PMID:27216423] Mahmood K,El-Kereamy A,Kim SH,Nambara E,Rothstein SJ ANAC032 Positively Regulates Age-Dependent and Stress-Induced Senescence in Arabidopsis thaliana. Plant Cell Physiol., 2016. 57(10): p. 2029-2046 [PMID:27388337] Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining. PLoS ONE, 2016. 11(9): p. e0162327 [PMID:27618630] Allu AD,Brotman Y,Xue GP,Balazadeh S Transcription factor ANAC032 modulates JA/SA signalling in response to Pseudomonas syringae infection. EMBO Rep., 2016. 17(11): p. 1578-1589 [PMID:27632992] Mahmood K,Xu Z,El-Kereamy A,Casaretto JA,Rothstein SJ The Arabidopsis Transcription Factor ANAC032 Represses Anthocyanin Biosynthesis in Response to High Sucrose and Oxidative and Abiotic Stresses. Front Plant Sci, 2016. 7: p. 1548 [PMID:27790239] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Zhao J,Missihoun TD,Bartels D The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana. Planta, 2018. 248(4): p. 1017-1027 [PMID:30027414]