PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00007249-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 146aa MW: 16886 Da PI: 8.8986 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.1 | 1.5e-16 | 64 | 107 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 WT+eE+ ++++a k++G W++I +mg ++t q++s+ qk+ PSME_00007249-RA 64 EIWTEEEHHKFLEALKMHGQA-WRRIEDHMG-TKTTVQIRSHAQKF 107 56*****************99.*********.************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 1.12E-15 | 57 | 110 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.609 | 58 | 112 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.9E-9 | 60 | 108 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 4.7E-15 | 61 | 110 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 2.8E-10 | 62 | 110 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.89E-9 | 66 | 108 | No hit | No description |
Pfam | PF00249 | 4.5E-14 | 66 | 106 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007623 | Biological Process | circadian rhythm | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0009845 | Biological Process | seed germination | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
SFVQGEITEA PAGQQGIQSN DVHHSEPSKS QTPSIRFSSD EVSSSGDEFT TKVRKPYTIT 60 KQREIWTEEE HHKFLEALKM HGQAWRRIED HMGTKTTVQI RSHAQKFFSK VFFLYGSPMV 120 EKYFLIYSLT AILVIVSFSW RLTSDR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Positive regulator for cold-responsive gene expression and cold tolerance. Part of a regulatory feedback loop that controls a subset of the circadian outputs and modulates the central oscillator. Negatively self-regulates its own expression. {ECO:0000269|PubMed:17587236, ECO:0000269|PubMed:23371945}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Up-regulated transiently by light. {ECO:0000269|PubMed:17587236, ECO:0000269|PubMed:19805390}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Swissprot | F4K5X6 | 2e-33 | RVE2_ARATH; Protein REVEILLE 2 | ||||
TrEMBL | A0A0C9S8A2 | 6e-48 | A0A0C9S8A2_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_11910_4056 transcribed RNA sequence | ||||
STRING | Pavir.J34894.1.p | 2e-33 | (Panicum virgatum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G37260.1 | 1e-35 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|