PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PSME_00007097-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 82aa MW: 9515.79 Da PI: 4.5356 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 128 | 3.2e-40 | 1 | 73 | 30 | 102 |
NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdelk 102 +k+dedv+misaeaPv+++kace+fi elt+r+w+h+eenkrrtl+k+diaaa++rtdifdflvdivprdelk PSME_00007097-RA 1 MKSDEDVRMISAEAPVVFAKACEMFINELTMRAWIHTEENKRRTLQKNDIAAAIARTDIFDFLVDIVPRDELK 73 9*********************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.1E-32 | 1 | 69 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.5E-25 | 1 | 69 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.8E-17 | 1 | 54 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 82 aa Download sequence Send to blast |
MKSDEDVRMI SAEAPVVFAK ACEMFINELT MRAWIHTEEN KRRTLQKNDI AAAIARTDIF 60 DFLVDIVPRD ELKEDQETHG SY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 5e-40 | 1 | 69 | 27 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 41 | 47 | RRTLQKN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF084647 | 1e-82 | EF084647.1 Picea sitchensis clone WS02719_H11 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020532226.1 | 1e-44 | nuclear transcription factor Y subunit C-2 isoform X1 | ||||
Refseq | XP_020532230.1 | 1e-44 | nuclear transcription factor Y subunit C-2 isoform X2 | ||||
Swissprot | Q8LCG7 | 1e-44 | NFYC2_ARATH; Nuclear transcription factor Y subunit C-2 | ||||
TrEMBL | A9NTJ8 | 6e-44 | A9NTJ8_PICSI; Uncharacterized protein | ||||
STRING | ERM93786 | 5e-44 | (Amborella trichopoda) | ||||
STRING | Cagra.1310s0011.1.p | 4e-44 | (Capsella grandiflora) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G56170.2 | 4e-47 | nuclear factor Y, subunit C2 |
Publications ? help Back to Top | |||
---|---|---|---|
|