PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PSME_00003516-RA

Organism

Pseudotsuga menziesii

Taxonomic ID

3357

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

NAC

Protein Properties

Length: 154aa MW: 17479.3 Da PI: 10.2272

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00003516-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	135.4	3.8e-42	36	154	2	120
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 ppGfrF Ptdeelvv+ L+kkv+++ +++ +i+evd+yk++Pw+Lp k+ +ekewyfF++rd+ky++g+r++r++ sgyWkatg dk++ + PSME_00003516-RA 36 PPGFRFFPTDEELVVHDLCKKVASQIIHV-PIIAEVDLYKYDPWQLPDKALFGEKEWYFFTPRDRKYPNGSRPKRVAGSGYWKATGADKPINA 127 9*************************9.88***********8777899*********************************** PP NAM 95 k.kgelvglkktLvfykgrapkgektd 120 k +++ vg+kk Lvfy g+apk +kt+ PSME_00003516-RA 128 KgGKKRVGIKKDLVFYAGKAPKVSKTN 154 966777****************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.29E-45	28	154	IPR003441	NAC domain
PROSITE profile	PS51005	45.271	35	154	IPR003441	NAC domain
Pfam	PF02365	2.5E-18	36	146	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 154 aa Download sequence Send to blast
MGGIKGLGTI RVAIHLEELC KQARDHYALL VHNQWPPGFR FFPTDEELVV HDLCKKVASQ 60 IIHVPIIAEV DLYKYDPWQL PDKALFGEKE WYFFTPRDRK YPNGSRPKRV AGSGYWKATG 120 ADKPINAKGG KKRVGIKKDL VFYAGKAPKV SKTN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	4e-59	30	154	12	134	NO APICAL MERISTEM PROTEIN
1ut4_B	4e-59	30	154	12	134	NO APICAL MERISTEM PROTEIN
1ut7_A	4e-59	30	154	12	134	NO APICAL MERISTEM PROTEIN
1ut7_B	4e-59	30	154	12	134	NO APICAL MERISTEM PROTEIN
3swm_A	4e-59	30	154	15	137	NAC domain-containing protein 19
3swm_B	4e-59	30	154	15	137	NAC domain-containing protein 19
3swm_C	4e-59	30	154	15	137	NAC domain-containing protein 19
3swm_D	4e-59	30	154	15	137	NAC domain-containing protein 19
3swp_A	4e-59	30	154	15	137	NAC domain-containing protein 19
3swp_B	4e-59	30	154	15	137	NAC domain-containing protein 19
3swp_C	4e-59	30	154	15	137	NAC domain-containing protein 19
3swp_D	4e-59	30	154	15	137	NAC domain-containing protein 19
4dul_A	4e-59	30	154	12	134	NAC domain-containing protein 19
4dul_B	4e-59	30	154	12	134	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in stress response. {ECO:0000250\|UniProtKB:Q7F2L3}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress (PubMed:18813954, PubMed:20632034). Induced by dehydration, cold stress and methyl jasmonate (PubMed:20632034). {ECO:0000269\|PubMed:18813954, ECO:0000269\|PubMed:20632034}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_026426066.1	1e-63	NAC domain-containing protein 68-like
Swissprot	Q39013	2e-61	NAC2_ARATH; NAC domain-containing protein 2
Swissprot	Q52QH4	2e-61	NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBL	A0A3G2WJF9	2e-68	A0A3G2WJF9_PICWI; NAC2
STRING	XP_010257746.1	5e-62	(Nelumbo nucifera)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	8e-64	NAC family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Taga Y, et al. Role of OsHSP90 and IREN, Ca2+ dependent nuclease, in plant hypersensitive cell death induced by transcription factor OsNAC4. Plant Signal Behav, 2009. 4(8): p. 740-2 [PMID:19820348] Xia N, et al. Characterization of a novel wheat NAC transcription factor gene involved in defense response against stripe rust pathogen infection and abiotic stresses. Mol. Biol. Rep., 2010. 37(8): p. 3703-12 [PMID:20213512] Takasaki H, et al. The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol. Genet. Genomics, 2010. 284(3): p. 173-83 [PMID:20632034] Florentin A,Damri M,Grafi G Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization. Dev. Dyn., 2013. 242(10): p. 1121-33 [PMID:23798027] Jensen MK, et al. ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana. FEBS Open Bio, 2013. 3: p. 321-7 [PMID:23951554] Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Nakayama A, et al. Genome-wide identification of WRKY45-regulated genes that mediate benzothiadiazole-induced defense responses in rice. BMC Plant Biol., 2013. 13: p. 150 [PMID:24093634] Yang X, et al. Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis. Plant Cell Rep., 2015. 34(6): p. 943-58 [PMID:25666276] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Ootsubo Y,Hibino T,Wakazono T,Mukai Y,Che FS IREN, a novel EF-hand motif-containing nuclease, functions in the degradation of nuclear DNA during the hypersensitive response cell death in rice. Biosci. Biotechnol. Biochem., 2016. 80(4): p. 748-60 [PMID:26766411] Liu Y,Sun J,Wu Y Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice. J. Plant Res., 2016. 129(5): p. 955-962 [PMID:27216423] Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining. PLoS ONE, 2016. 11(9): p. e0162327 [PMID:27618630] Zhao J,Missihoun TD,Bartels D The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana. Planta, 2018. 248(4): p. 1017-1027 [PMID:30027414]